KEGG   Cellulophaga algicola: Celal_0066Help
Entry
Celal_0066        CDS       T01404                                 

Definition
(GenBank) transport system permease protein
  KO
K02015  iron complex transport system permease protein
Organism
cao  Cellulophaga algicola
Pathway
cao02010  ABC transporters
Module
cao_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Celal_0066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cao02000]
    Celal_0066
Transporters [BR:cao02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Celal_0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD Nicastrin
Motif
Other DBs
NCBI-ProteinID: ADV47424
UniProt: E6X6C4
Position
69287..70285
Genome map
AA seq 332 aa AA seqDB search
MLLVLILCVFFVINISLGSVHIPLKSTFHTLFGGADVRESWDYIIWNYRVPKAITAILVG
GGLSLSGLLMQTLFRNPLAGPFVLGISSGASLGAALLIMGAGLFSTLFSISLFNDVSLAI
ASSLGSFLVLLAVLSVAMKIKDTMSLLIIGLMFGSITGALVSVLSYFTTSEQLQQYIYWS
FGSLGDLSWPQLALLTGITSIGVLLSVFSIKSLNAFLLGENYARSLGVSLKKSRFIIIIA
TGLLAGGITAFAGPIAFIGLAVPHLTRQIFNTTDHKILVPAVLVYGAILMLICDSIAQLP
LSASVLPINAITSLVGAPVVVWLLVRKRKMIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgctattagtactaattttgtgcgtcttttttgtaataaatataagtttaggttcagta
catattcctttaaaaagcaccttccatacactttttggtggtgcagatgtacgtgaatca
tgggattacattatttggaactatagagtcccaaaagcaattacggcaatacttgttggt
ggaggcctgtccttaagcggcttgttaatgcaaacgcttttccgtaaccctttagcagga
ccttttgtcttaggaataagttctggcgctagtttgggggctgcgctattgattatggga
gctgggttattttcaacacttttcagtatttccctttttaatgatgtttctttagccatt
gcctctagtttaggaagctttctagtattgctcgctgtactgtctgttgccatgaaaata
aaagacaccatgtcattacttattatagggcttatgtttgggagtataactggtgcgcta
gttagtgttctctcctactttactacttcagaacaattacaacaatatatctattggagt
tttggaagtttaggagatttatcatggccacaattagcgctacttactgggattaccagt
attggtgtactgctaagtgtcttctctattaaatctttgaatgcctttttattaggcgaa
aattatgcaagaagccttggagttagtctaaaaaaatctagattcattattatcattgct
actgggttattagccggaggtattacagcctttgcaggacctattgcttttatcggttta
gcagtgccccatttaacccgacaaatatttaataccacagatcataaaatacttgtaccc
gctgtgttagtctatggcgcaattttaatgttaatttgtgatagtattgcgcaattacca
ttatcagcaagtgtattacctataaatgccattacaagcttagtaggcgctcctgttgtg
gtatggttgttagttagaaaacgtaaaatgattttttaa

DBGET integrated database retrieval system