KEGG   Cellulophaga algicola: Celal_0071Help
Entry
Celal_0071        CDS       T01404                                 

Definition
(GenBank) thioesterase superfamily protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT
Motif
Other DBs
NCBI-ProteinID: ADV47429
UniProt: E6X6C9
Position
73874..74416
Genome map
AA seq 180 aa AA seqDB search
MKEYKTSKESRVSITELMLPAHSNFGGKVHGGHILNLMDQIAFACASKHSRSYCVTASVN
KVDFLNPIEVGELVTLKASINFTGRTSMVVGVRVESENIRTGKKKHCNSSYFTMVAKDLE
GKSIPIPGLIVDSIESVRRFSRSIQRKSESSSRTSRFDSANFKVDDYIAHLEGENMKLDL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataaaacatctaaagaatcaagagtatctataacagaattaatgctgcct
gcgcactctaattttggcggtaaagttcatggagggcacattttaaacctaatggatcag
attgcctttgcttgcgcctctaaacattctagaagctattgcgttacagcatctgtaaat
aaagtagattttttaaaccctattgaagttggtgaattggtgaccttaaaagcatcgata
aattttacaggtagaacctcaatggttgttggtgttagagtagaatctgaaaatattaga
acaggtaaaaagaaacattgcaactcttcttattttaccatggttgccaaagatcttgaa
ggtaaaagtattccaataccagggttaattgtagactcaattgaaagtgtacgtagattt
tctcgaagcatccaaagaaaatcagaatcctcatcaagaacaagtcgttttgattctgct
aactttaaagttgatgattatatagcacacttagaaggtgagaacatgaagttggattta
taa

DBGET integrated database retrieval system