KEGG   Cellulophaga algicola: Celal_0073Help
Entry
Celal_0073        CDS       T01404                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_8 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: ADV47431
UniProt: E6X6D1
Position
76330..76845
Genome map
AA seq 171 aa AA seqDB search
MTIKNSRIEDIDEIFRLYKIASDYQKEKKKVVVWPEFKRVLVATEIAEKRQWKMIIDDEI
ACLWAITFSDAQIWEERDNATSIYIHRIATNPKFRGNNYMNTIVTWAKTYAQSTEKQFIR
LDTLGNNTKLIEHYQKAGFDFLGMFDLKNTDMLPDHYQDQPACLFEIDLGQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatagcagaattgaagacattgatgaaattttcagactttataaaata
gcctctgactatcagaaagaaaaaaagaaagtggttgtttggccagaattcaaaagagta
ttggtagcgactgaaatagcagaaaaaaggcaatggaaaatgataattgatgatgaaata
gcatgtctttgggctattacctttagtgatgcacaaatttgggaagaaagagataatgct
acctctatctacattcacaggattgctactaaccccaaattcagaggcaacaactatatg
aacactattgtaacttgggcaaaaacctatgcacaatctacagaaaaacagtttatacgt
ttagacaccttagggaataataccaaactaatcgaacattaccaaaaggccggattcgac
tttttaggaatgttcgatttgaaaaatactgatatgttacctgatcattatcaggaccaa
cctgcctgtttgtttgaaatagatttaggacaataa

DBGET integrated database retrieval system