KEGG   Cellulophaga algicola: Celal_0082Help
Entry
Celal_0082        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMN_transporter Sel1 FUSC_2
Motif
Other DBs
NCBI-ProteinID: ADV47439
UniProt: E6X6Z0
Position
86804..87319
Genome map
AA seq 171 aa AA seqDB search
MFNKIFKLIIAGLIIAYAIYQFIEGNIGNGIFLILFSLIFIFLYFRNEIILLAFLKMRKQ
DLVGTEKWLSKIKNPEAALTLKQQGYYNYLHGIIFSQTNLTTAEKYFKKALKLGLTMDYD
VAMAKLSLAGISMQKRRKREATMLLNEAKKLDKQGMLTDQIKMMKVQLKKI
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaaatttttaaattaataattgcaggcttaattatagcatatgctatatac
caatttattgaaggcaacattggtaatggcatctttttaatcttgttctctttaattttt
atattcctttattttagaaacgaaattatacttcttgcctttttaaaaatgcgtaagcaa
gatttagtaggaactgaaaaatggttatctaaaattaaaaaccctgaagcggcattaaca
ttaaagcaacaaggttattacaactacttacatgggatcattttttcccagacaaatcta
actactgctgaaaaatactttaaaaaagctttaaagcttggcttaacgatggattacgac
gttgctatggctaaattaagccttgcgggtatctctatgcagaaaagaagaaaaagagaa
gctacaatgcttttaaatgaagccaaaaaattagacaagcaaggtatgcttacggatcaa
attaagatgatgaaagtacaattgaagaaaatataa

DBGET integrated database retrieval system