KEGG   Cellulophaga algicola: Celal_0085Help
Entry
Celal_0085        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
  KO
K06975  uncharacterized protein
Organism
cao  Cellulophaga algicola
Brite
KEGG Orthology (KO) [BR:cao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Celal_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ADV47442
UniProt: E6X6Z3
Position
89217..89513
Genome map
AA seq 98 aa AA seqDB search
MNEVNITDNSFLRQFETTVNGHLAKIEYSAQERKIFLTKLIIPETITQEDFKEQFIEAVL
NVIQERNLRVVPTSPEIAGFLRKNSRKYKDMLPVGIRI
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtaaacattacagacaatagtttcttacgccaatttgaaacaacggttaat
gggcacttagcaaagattgaatattctgctcaggaaagaaagatttttttaactaaatta
attattcctgaaacaattacccaagaagactttaaagaacaattcattgaagccgtgtta
aacgtaattcaagaaagaaatttacgcgtagtacctacaagtccagaaatagctggattt
cttagaaaaaatagcagaaaatacaaagatatgctccctgtaggcattcgaatctaa

DBGET integrated database retrieval system