KEGG   Cellulophaga algicola: Celal_0100Help
Entry
Celal_0100        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: ADV47457
UniProt: E6X708
Position
complement(106674..106955)
Genome map
AA seq 93 aa AA seqDB search
MVLKILSIKNGTFKVAGKINATTAPQFQSNFESNLDSLNKLTLDIDEITEVDAAGMKALR
ALYKKAFLENKSFSIIGNGCKDIYDDFRGCEIT
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggtgctaaaaattttaagtattaaaaacggaacatttaaagtagcaggtaaaatcaat
gcaactacagctcctcagttccaatcgaattttgaatctaatcttgattctttaaataaa
ttaacattagatattgatgagattacggaagtagatgctgctggaatgaaagctttaaga
gcgttgtacaaaaaagcttttttagaaaataaatcgttttctattataggaaacgggtgt
aaggatatctatgacgattttagagggtgtgaaattacctaa

DBGET integrated database retrieval system