KEGG   Cellulophaga algicola: Celal_0103Help
Entry
Celal_0103        CDS       T01404                                 

Definition
(GenBank) regulatory protein MarR
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 RP-C HTH_Crp_2 TrmB
Motif
Other DBs
NCBI-ProteinID: ADV47460
UniProt: E6X711
Position
112134..112586
Genome map
AA seq 150 aa AA seqDB search
MKELTIDYALRATWQAVARMYNEEAKNFETTMAVGFTLLSIDPKTGTPSTALGPKMGMEA
TSLSRILKSMEEKGLIIRKPNPNDGRGVLIHLTPFGLEKRVDSKNVVLRFNEVVKDSVQE
DQLNGFFKVMDTINKLVIDKKIYTKDSKTI
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcttacaatagattatgctttaagagctacatggcaagctgttgccagaatg
tataacgaagaagctaaaaattttgaaactaccatggcggtaggtttcactttattgagc
attgatcctaaaacaggtaccccttctactgcattaggtcctaaaatgggaatggaagca
accagtctgtctcgcatactaaaaagtatggaagaaaaaggattgattattagaaaaccc
aatccaaatgatggaagaggtgttttaattcacctaacgccatttggcttagaaaaaaga
gtagattcaaaaaatgttgtccttcgctttaacgaagtggttaaggatagcgttcaagaa
gatcaattaaatggttttttcaaagttatggataccattaataaactggttatagataag
aaaatttacactaaagattcaaaaacaatttaa

DBGET integrated database retrieval system