KEGG   Cellulophaga algicola: Celal_0104Help
Entry
Celal_0104        CDS       T01404                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
cao  Cellulophaga algicola
Pathway
cao00071  Fatty acid degradation
cao00362  Benzoate degradation
cao00650  Butanoate metabolism
cao01100  Metabolic pathways
cao01120  Microbial metabolism in diverse environments
cao01200  Carbon metabolism
cao01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Celal_0104
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Celal_0104
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Celal_0104
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Celal_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 Pyr_redox_2 ApbA NAD_binding_2 UDPG_MGDP_dh_N NAD_binding_8 Pyr_redox NAD_Gly3P_dh_N 2-Hacid_dh_C DAO Asp1
Motif
Other DBs
NCBI-ProteinID: ADV47461
UniProt: E6X712
Position
112592..115006
Genome map
AA seq 804 aa AA seqDB search
MNSMNKHIKKVAVVGSGIMGSGIACHFANIGVEVLLLDIVPRELNEKEKAKGFTLEDKVV
RNRLVNDSLIAALKSKPSPIYNQKFADRITTGNLEDDIAKVSQVDWIIEVVVERLDIKKM
VFENLEKHRKPGTLITSNTSGIPIHFMSEGRSEDFQKHFCGTHFFNPARYLKLFEIIPGP
KTSPEVLDFLNGYGEQFLGKTSVIAKDTPAFIGNRIGIFSIQSLFHMVKDLGMTVEEVDK
LTGPVIGRPKSATFRTVDVVGLDTLVHVANGIAENCKDDEKLDLFKLPTFINTMMENKWL
GSKTGQGFYKKSKDAKGKTEILTLDLDTMDYRASKKASFATLELTKTIDKVADRFKVLVA
GKDKAGEFYRKSFAALFAYVSHRIPEITDELYKIDDAMKAGFGWEHGPFQIWDAIGIEKG
IEIMKAEGETPAAWVNDMLASGTKSFYAVKDGATYFYDIPKKAIEKVPGQDSFIILDNIR
KSKEVFKNSGVVVEDLGDGILNVEFQSKMNTIGGDVLAGLNKAIDIAEKDFQGLVVGNQA
PNFSVGANIGMIFMMAVEQEYDELNMAIKMFQDTMMRMRYSAIPTVAAPHGMALGGGCEL
SLHADMVVAAAETYIGLVEFGVGVIPGGGGSKEFAVRAQDQFHKNDVELNVLQEYFLTIG
MAKVSTSAYEAFDLGILQKGKDIVVVNKDRQIATAKAHAKLMAEGGYTQPVKRKDIKVLG
KQALGMFLVGTDSMEDSKYISEHDKKIANKLAYVMAGGDLSEPTLVTEQYLLDLEREAFL
SLCTERKTLERIQHMLKTGKPLRN
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgatgaataaacacattaaaaaagtagccgttgttggttctggaattatggga
agtggcatagcatgtcatttcgcaaatatcggagttgaagtattattactagatattgta
cctagagaacttaatgaaaaagaaaaagccaaaggctttacgcttgaagataaggtggtc
cgcaatagattggtaaatgattcattaatcgcagcattaaaatctaagccatctcctatt
tacaatcagaaatttgctgatcgtattacaacaggaaatcttgaagatgatatagcaaag
gtttctcaggtagattggattattgaagttgtagttgaaagacttgacattaaaaagatg
gtctttgaaaatttagaaaagcacagaaaacccggtacacttattacctctaacacatca
ggtattccaattcactttatgagtgaagggcgtagtgaagatttccagaaacatttctgt
ggaacgcacttctttaaccctgcacgttacttaaaactttttgaaataatccctggacct
aaaacttcaccagaagtattagatttcttaaatggttatggtgagcaattcttaggaaaa
acttctgtaattgctaaagatactcctgcttttattggaaacagaataggtatttttagt
atccaaagtctcttccatatggtaaaagatttaggaatgacggttgaagaagtagataaa
ttaacaggacccgttattggtcgtccaaaatcagcaacatttagaactgttgatgtggta
ggattagatactttggttcatgttgctaacggaattgcagaaaattgcaaggacgatgag
aaattagacttatttaaattgcctacgttcatcaataccatgatggaaaacaaatggttg
ggtagtaaaacaggtcaaggtttttacaaaaaatctaaagatgctaaaggcaaaacagaa
atcttaacgcttgatttagacacgatggactatcgtgcaagtaaaaaagcaagtttcgct
actttagaattaacgaagactattgataaagtagctgatcgttttaaagtattagtagca
ggaaaagataaagctggtgaattttacagaaagagttttgctgcattatttgcttatgta
tcgcatagaattccagaaataacggatgagctttataagattgatgatgcaatgaaagct
ggatttggttgggaacatggacctttccaaatttgggatgctattggtatagaaaaaggt
attgaaattatgaaggcagaaggagaaactcctgctgcttgggtaaatgatatgcttgct
agtggaacaaaatcattctacgcagtaaaagacggcgctacttatttttatgatattcct
aaaaaagctatagaaaaagttccaggtcaagattcatttatcattttagataatattaga
aagtctaaagaagttttcaaaaacagtggtgttgttgtagaagatttaggtgatggaatc
cttaatgtagaattccaatctaaaatgaataccattggtggtgatgttcttgcgggttta
aataaagctatagatattgctgagaaagatttccaaggattagttgttggaaaccaggca
ccaaacttctctgtaggtgctaacatcgggatgattttcatgatggccgtagaacaagag
tatgatgaattgaacatggcgattaaaatgttccaagatacgatgatgcgtatgcgttat
tctgcaataccaaccgtagctgctcctcacggaatggcactaggtggtggttgtgagctt
tcattacacgcagacatggtcgtagctgcagcagaaacttatattggtttagtagaattt
ggtgttggtgtcatccctggtggtggtggttctaaagaatttgctgtaagagcacaagac
caattccataaaaacgatgttgaattaaatgtacttcaagaatatttcttaacaataggt
atggctaaggtctctacctcagcatatgaagccttcgatttaggaattttacaaaaaggt
aaagatatcgtagttgttaataaagaccgtcaaattgctacggcaaaggcacatgctaag
ttaatggctgaaggtgggtatacgcaaccggtaaaacgtaaagacattaaagttttagga
aaacaagctttaggaatgttcttagtaggtacagattccatggaagacagtaaatacatt
agtgagcacgacaaaaagattgctaataaattagcgtacgttatggctggtggagattta
tcggaacctacgttagttacagagcaatatttattagatctagagcgtgaagcattttta
tctctttgtacagaacgtaaaacattagaaaggattcagcatatgttgaaaacaggaaaa
cctttaagaaactaa

DBGET integrated database retrieval system