KEGG   Cellulophaga algicola: Celal_0106Help
Entry
Celal_0106        CDS       T01404                                 

Definition
(GenBank) Butyryl-CoA dehydrogenase
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ADV47463
UniProt: E6X714
Position
116452..118251
Genome map
AA seq 599 aa AA seqDB search
MAEKEILRGGQFLVKETNCEDIFTLEDLSEEQKMMRDSTKEFVDRELWAHWERFEKKDYA
YTEETMRKAGELGLLSVAVPESYGGMGMGFVSTMLVCDYISGATGSFSTAFGAHTGIGTM
PITLYGTEEQKQKYVPKLASGEWFGAYCLTEPGAGSDANSGKTKAVLSEDGKHYSISGQK
MWISNAGFCSVFIVFARIGDDKNITGFIVENDPSNGISLGDEEKKLGIHSSSTRQVFFNE
TKVPVENMLSDRGNGFKIAMNALNVGRIKLAAACLDAQRRVIGEATKYANERIQFKTPII
NFGAIKAKIANMVTNVYADESAAYRAAKNIEDRIAMREAAGNSHQEAELKGVEEYAIECS
ILKVAVSEDCQSTTDEGIQIFGGMGFSADTPMESAWRDSRIARIYEGTNEINRMLAVGML
VKKAMKGHVDLLGPATKVGEELMGIPSFDTPDFSELFAEEKDLVAKLKKVFLMVAGSAVQ
KYGAELENHQQLMMSASDILIEVYMAESTILRTEKNVKRFGEAEQATQIAMSKLYLYTAV
DTVIQRGKEAIVSFAEGDEQRMMLMGLKRFTKYTNNPNVVALRTQIADKVAADNGYTFD
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaagaaatactacgtggcggtcagtttttagtaaaagaaacgaactgtgaa
gatatctttacgctcgaagatttatcggaagagcaaaaaatgatgcgagatagcaccaaa
gaattcgtagatcgcgaactttgggcacactgggaacgctttgagaaaaaagattacgca
tatacggaagaaactatgcgtaaagcgggtgaacttggcttattaagcgtagcggttcca
gaatcttacggaggaatgggtatgggttttgtctctaccatgttagtatgtgattatatt
tctggtgctacaggttcttttagtactgcttttggtgcgcatactggtattggtactatg
ccaattacgttatatggtactgaggaacaaaaacaaaaatacgttcctaaattagcctct
ggtgagtggtttggtgcttattgccttactgaaccgggtgcaggttctgatgctaactct
ggtaagaccaaagcggttttatctgaagacggcaaacactatagtatttctggtcaaaaa
atgtggatttcaaatgcaggtttctgtagtgtattcatagtttttgctagaattggtgat
gataaaaatataacaggatttattgttgagaatgatcctagtaatggtatttctttaggt
gatgaagaaaaaaaattaggaattcattcttcttctacgcgtcaagtattctttaatgaa
acaaaggtgcctgtagagaatatgctttctgatagaggaaacggatttaaaattgcgatg
aatgcgcttaacgtaggtagaattaaattagctgcggcttgtttagatgcgcaacgtcgt
gttattggtgaggctactaaatacgctaacgagcgtattcagtttaaaacacctatcata
aactttggtgctataaaagctaaaatagcgaatatggttactaatgtttatgctgatgaa
tctgctgcctatagagctgctaaaaatattgaagacagaattgcaatgcgtgaagctgca
ggaaactctcatcaagaagcagaactaaaaggtgtcgaagaatatgctattgaatgttct
attttaaaagtagcagtttctgaagattgccaaagtacaacagatgaaggtattcagatt
tttggaggtatgggctttagtgcagatacaccaatggaatctgcttggagagattctcgt
attgctcgtatttacgaaggtaccaatgaaattaaccgtatgttagcagtaggtatgctt
gttaagaaagcaatgaaaggtcatgtagatcttttaggacctgcaactaaagttggtgaa
gaattaatgggaataccttcttttgatacaccagatttttctgagctttttgctgaagaa
aaagatttggttgctaaattgaagaaagtatttttaatggtagctggttctgccgttcaa
aaatatggtgctgaattagagaaccaccaacaattgatgatgtctgcttctgatatatta
attgaagtatatatggcagaatctacgatattaagaactgagaaaaacgtaaaacgattt
ggagaagcggaacaagctacacaaatcgcgatgtctaaattatatttatatactgctgta
gacactgtaatccaaagaggaaaagaagctattgtttcttttgctgaaggtgatgagcaa
cgtatgatgttaatgggccttaagcgttttacaaaatatactaataatcctaacgtagta
gctttacgcacacaaattgcggataaagtagctgcagacaacggttatacctttgactaa

DBGET integrated database retrieval system