KEGG   Cellulophaga algicola: Celal_0107Help
Entry
Celal_0107        CDS       T01404                                 

Definition
(GenBank) glycoside hydrolase 15-related protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ADV47464
UniProt: E6X715
Position
complement(118477..120282)
Genome map
AA seq 601 aa AA seqDB search
MDNLDYGIIGNCRSAALISKNGSMDWCCLPEFDSPSVFAKLLDEEIGGSFGIEVEDTYKI
HQFYDAETAILITKFTEGEENCFEIHDFMPRYHKDDDSFFAPPEVIRYIKLVAGKPKFKV
VYNPKLEYAQGKTESFIKKDFIASLTHDVKFDTVFLYTSFDKEKVLNGEEIIVEENGFFL
LTYNEKIFTPTTERVFLNLERTRIYWMDWSQKTPTYKKFDKEIKRSALTLKLLSYDKTGA
VLAAATTSLPETIGEVRNWDYRFCWIRDASMVIKVVSQLGHKNVAKRYLQFIIDLIPDKD
EKLQIMYGINREKKLTEQTLEHLSGYKGSKPVRIGNAAYEQVQNDIYGILMDVIYEMISQ
FSIDIQNGEELWGITKGIVWIVEKHWQEPDKGIWEFRSEDRHFTFSKVLCWTAIDRAIKV
AELLDKKHKIDKWRPLEQKIKKDIMENAWNEEKQAFTQSYGSSDMDASVLLMQSYGFIDA
KDPKYVSTVLAVEKDLCNDGLLYRYKNEDDFGEPSSSFTICTFWFINSLFKIGQEEKALQ
HFEQLLSYSNHLGLFSEDVDFKTKRLLGNFPQAYSHLALIECAINFSNKASEENVLESMR
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggataatttagactacggaataataggaaattgtaggagtgcagcattaatttctaag
aatggttcaatggattggtgttgtttaccagaatttgattcaccatcagtttttgcaaaa
cttctcgatgaagaaataggagggagttttggtattgaggtagaagacacttataagata
catcagttttatgatgccgaaacggcaatattaattacgaaatttacagaaggcgaagaa
aattgttttgaaattcatgactttatgcctaggtatcataaggatgatgattcatttttt
gcaccgccagaggttatcagatatataaaactggtagcagggaaaccaaaatttaaagtg
gtttacaacccaaaattagaatacgcacaaggaaaaactgaatcgtttataaaaaaagat
tttatagcaagcttaacacacgatgtaaagtttgataccgttttcttatacacttcattt
gataaagaaaaagtgctaaatggagaagaaattatagtagaagaaaatgggttttttctg
ttaacgtataatgagaaaatatttacacctacaacagaaagagtatttttaaatttagaa
cgtacccgtatttattggatggattggtcacaaaaaacgccaacctataagaagtttgat
aaagagattaaacgtagcgcattaactttaaaattgttgagttatgataaaacaggggca
gtattagctgcggcaacaacatctcttccagaaacaataggagaggttcgtaattgggat
tacagattctgttggattcgtgatgcttctatggtaattaaagtggtctctcaattaggg
cataaaaatgtagctaagcggtatttgcaatttattattgatttgattcctgataaagat
gaaaagttacagatcatgtatggcattaaccgcgagaaaaagctaacagagcaaacctta
gagcacttaagtgggtataaaggatctaaacctgttagaattggtaatgcagcttacgag
caagttcagaatgatatttatggaattctgatggatgtgatttatgaaatgatttctcaa
tttagtatagacatccaaaatggggaggaactttggggtattactaaaggcattgtttgg
attgtagagaagcactggcaagaaccagataaaggtatttgggagttccgttcagaagat
aggcattttacattttctaaggttttatgctggaccgccattgatagggctataaaagtg
gcagagttgttagacaagaaacataaaattgataaatggagaccattagagcagaaaatt
aaaaaagatatcatggagaatgcttggaatgaagagaaacaagcctttacacaatcctat
ggttcttcagatatggatgcttccgtattattaatgcagtcttatggatttattgatgct
aaagatccaaaatacgtaagtacagttttagctgtagagaaagatttatgtaatgatggt
ttattgtaccggtataaaaatgaagatgattttggagaaccttcatcatcatttacaatt
tgtacgttttggtttatcaatagcttattcaaaatagggcaggaagaaaaagcattacaa
cattttgagcaattgttgagttatagtaatcacttaggcttgtttagtgaagatgtagat
tttaaaacaaaacgtttgttagggaacttcccgcaagcatattcacatttagcattgata
gaatgtgcaataaacttttctaataaagcatctgaagagaacgtattagagtctatgcgt
gattaa

DBGET integrated database retrieval system