KEGG   Cellulophaga algicola: Celal_0111Help
Entry
Celal_0111        CDS       T01404                                 

Definition
(GenBank) protein of unknown function DUF1080
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1080
Motif
Other DBs
NCBI-ProteinID: ADV47468
UniProt: E6X719
Position
complement(125239..126180)
Genome map
AA seq 313 aa AA seqDB search
MKVYTSTLSLLLVLLVSSVATRINAQDKSPLIGRWDMVIQQEGKELPSWLEITKSGSATL
VGRFVYAFGSSRPIAEVKVKNEVFSFVIPRQWEPGDKDMKFEGSLAGTTLSGTMVYSDGK
KYKWTATPAKVAVYNEAIVWGAPKALFNGTSLNGWSAMGDNQWIVKDGILTSPKSGSNLV
SDEKFLNFKLHVEFKYPAGSNSGIYLRGRHEVQIEDNIGLEPSNILFGGIYGFLTPNEMM
AKPAGEWQSYDITLNGNRVSIIANGKAIITDQIIPGITGGALDSKEAEVGPLLIQGDHGP
VEFRSIVVTPELK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttacacttcaacactatccttacttttagtgctactggtttcttcagtcgct
actagaataaatgcacaagataaaagtccgcttattggtcggtgggatatggttatccaa
caagaaggcaaagaactaccttcttggttagagattacaaaatctggtagcgctacttta
gtaggaaggtttgtatatgcttttggcagttctaggcctatagccgaagtaaaagtaaaa
aacgaggtctttagttttgttattccacgacaatgggaaccaggcgataaagacatgaag
tttgaaggttcattagcgggtactacactttctggaactatggtgtattccgatggaaaa
aaatacaaatggacagctacaccagcaaaagtggcggtatataatgaagctattgtctgg
ggagcaccaaaagcacttttcaatgggactagtctaaacggatggagcgctatgggggat
aatcaatggattgtgaaagacggaattttaacgagtccaaaatctggctctaatttagtg
tctgatgaaaagttcttaaattttaagttacacgtagagtttaaatatccagcaggaagc
aatagtggtatttatttgcgtgggcgtcatgaagtgcaaattgaagataatataggctta
gaaccttctaatattttatttggaggtatttatgggtttctaacgccaaatgagatgatg
gcgaaaccagcaggggagtggcagtcttatgatattaccctaaacggaaaccgagtgagt
attatcgcaaatgggaaagccattattaccgatcaaataatcccaggaattactggtgga
gccttagatagtaaagaagcagaagtaggccctttgttaattcagggagatcatggccca
gtagaatttaggagtattgtagttacgccagaattaaagtaa

DBGET integrated database retrieval system