KEGG   Cellulophaga algicola: Celal_0114Help
Entry
Celal_0114        CDS       T01404                                 

Definition
(GenBank) MOSC domain containing protein
  KO
K07140  uncharacterized protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MOSC MOSC_N Chalcone_3
Motif
Other DBs
NCBI-ProteinID: ADV47471
UniProt: E6X722
Position
129408..130202
Genome map
AA seq 264 aa AA seqDB search
MKIEGLYIYPIKSTKGQKLIEITILKIGFENDRYLGIANAKNEIITARENAELLNIKTEI
NNYQLNISYKNETKTIALNKEFQDIELSLFHTSVAGKIISDELNNWFTALLNSESKLVKI
NLNKLRKTNDTAISFNDVYPIHLISRESVAALNDKLETPIESNRFRPNIIISGVKAFEEE
TWTHLIIGECEFKVVSKTERCSLITINPHNGVKDKKQEPLRTLAKAFKKDGKVNFGIYLI
PIKTGIIRDSDTLKIKTVGNKEYH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagaaggtttatatatttatccaattaagtctacaaaaggtcaaaaactgatt
gaaattactatacttaaaattggatttgaaaatgatcgctatctaggaatcgctaatgct
aaaaatgaaataataacagcgcgagaaaatgcagaattgcttaacattaaaacggaaata
aataattatcaactaaacattagttataagaatgaaactaaaacaattgctcttaacaaa
gaatttcaagacattgagctttcactatttcatacaagcgtagctggaaaaataataagc
gatgaactaaataattggtttactgctcttttaaattcagaaagcaaactagttaaaatc
aatttaaacaaattgcgaaagaccaatgatacagcgatatcgtttaatgacgtataccct
attcatttaatatccagagaatctgttgctgctttgaatgataaattagaaacccctatt
gaatccaatcgttttagacccaatatcattatttctggggttaaagcttttgaagaagaa
acttggacccatctaattattggtgaatgtgaatttaaagtcgtttctaaaacagagagg
tgttcgctaataaccattaacccgcataacggtgtaaaagataaaaaacaagaaccgctt
agaactttagcgaaagcatttaaaaaggatggcaaagttaattttggcatatatctgatt
ccaataaaaactggaattatacgagattctgatactttgaaaataaaaacggtaggtaat
aaggagtatcattaa

DBGET integrated database retrieval system