KEGG   Cellulophaga algicola: Celal_0138Help
Entry
Celal_0138        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47493
UniProt: E6X744
Position
151011..151631
Genome map
AA seq 206 aa AA seqDB search
MNICSLYNCCTIFMKNIIIYSSLFFLLSCTPNQKKETTETQGQKTTIVDSKLKLSDTLII
NKDLSISYLKIGSLNYSEFSEKDGAKFTKSKHGGLSCGESAPLWDSTISLKNDTIGIKLE
FSTTWVENLEEKKEEVLSQITLNKTKAKFYNGITIGKSDFTKTKVKFGEPEQESLNFLRY
KFEKINVSLIYNELGILDYVQMNAIN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatgttcattatacaattgttgtacaatatttatgaaaaacattattatctat
agttcattgttctttttattgtcttgtacgccaaatcaaaaaaaagaaactacagaaact
caaggacaaaaaactacgattgttgactctaaactaaaattgtctgacactctaattatt
aataaagatttgagtatttcctatttaaagattggctcattaaattattctgagtttagt
gaaaaggatggggcaaaatttacgaaatctaaacacggaggtttaagttgtggcgaatct
gcacctttatgggattcaactattagtctaaagaatgatacgattggaataaaactagag
tttagtactacttgggtggaaaatttagaagaaaagaaagaagaagttttatcacaaata
accttaaataaaacaaaagcaaaattttacaatggaataacaattggaaaatcagatttt
actaaaacaaaagtgaaatttggagaaccagaacaagaaagtttaaattttttacgctat
aagtttgaaaaaattaacgttagtttgatttataacgaacttggtattttagattatgtt
caaatgaatgcaataaactaa

DBGET integrated database retrieval system