KEGG   Cellulophaga algicola: Celal_0142Help
Entry
Celal_0142        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47495
UniProt: E6X746
Position
complement(154880..155194)
Genome map
AA seq 104 aa AA seqDB search
MKNIYKTIALSIVLLSGITEVTAQNRTSKTVATKKVSVKKVPSSKVVYKTPKSKVTTVRT
LPNKTNIKYNGQNYYYSNNKYYTYSQGHYVNIMPKVGFKIGVLP
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttataaaactatcgcattaagcatcgttctattgtctggaattacagaa
gtaactgctcaaaacagaacttccaaaacggtagctacaaaaaaagtttcggtaaaaaaa
gtaccatcatcaaaagtggtttataaaacgcctaaaagtaaagtaaccactgtgcgtaca
ttacccaacaaaactaacatcaaatacaatggacaaaattactattattcaaacaataag
tattacacttattcacaaggtcattacgtaaatataatgcccaaagtaggctttaaaata
ggagtgttaccttaa

DBGET integrated database retrieval system