KEGG   Cellulophaga algicola: Celal_0144Help
Entry
Celal_0144        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47497
UniProt: E6X748
Position
156322..156612
Genome map
AA seq 96 aa AA seqDB search
MNGKLLIGNEQLIGDCKIFKTEYLGALSSGGIGLITNDWSDNNIIYEFQPDGDLIVYEDF
PGGNSSVGTNHSAGKYSYELVYDFLYENSESKVLIL
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggaaaacttttaattggaaatgaacaattaattggtgattgtaaaatattcaaa
acagaatatttaggggcattaagtagtggaggtattggcttgattacaaatgattggtca
gataataatattatatatgaatttcaacctgatggagatttaattgtttatgaagatttc
cctggaggtaattcctcagtaggaactaaccacagtgcaggtaaatatagttatgaatta
gtatatgattttctttatgaaaatagcgagtcaaaagttttaatcttataa

DBGET integrated database retrieval system