KEGG   Cellulophaga algicola: Celal_0147Help
Entry
Celal_0147        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CARDB
Motif
Other DBs
NCBI-ProteinID: ADV47500
UniProt: E6X751
Position
158838..160451
Genome map
AA seq 537 aa AA seqDB search
MNKTKLIYLIVFLLSISVSEAQFIKKERPEGWENLVYGGRFMDRFLPMPNLKGMTKNTWG
SGAVIPRDINNGIEDNEWSYWGGNARLLDDGKYHLLVCRWAENSDKGHMEWPNSIVVHAI
SENSFGPYKVVQEIGKGHNPEWYITNNGNYVIAVNGGYYVSDTINGPWTYAKFDFNQRDR
KIIEKLSNLTFVKREDGSFLMVCRGGGIWASKDGISTWNQLTDSSVYPPVKGHFEDPLIW
KTNVQYHLIVNDWLGRIAWHMRSKDGINWKTDAGEAYLTGFSNYDNGIREDWFKYERIKV
LQDKFGRATQAHFAVIDTLKKQDRSNDNHSSKQIVIPLTVGKLISIIDKKTINSKTTKIA
VLIKKEEGFDPNTDIDMQSLRFGAPEKVDFGMGCKAEKIEREGDDALITFTGEGNGITDD
NFAAKLLGKDNQGNLLFGYSRLPGVSYLEAALSARKPVIDSLHNRLNVAVENFGQITSLE
SIIYVYKKNGEENIEMGYNVIPPLKPFEKTTININTLKPLSTLDDQKYLVVIRKREE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaaaattgatttatttgatagtatttctactatcaatttctgtttcagag
gctcaatttattaaaaaagaacgaccagaaggctgggaaaatcttgtttacggcggacgt
tttatggatcggtttcttcctatgcctaaccttaaggggatgacaaaaaatacttggggt
tcaggagccgtgattcctcgtgatataaacaacggtatagaagacaatgaatggtcttac
tggggaggaaatgcacgtttattggatgatggaaaatatcatctattggtgtgtaggtgg
gctgaaaattcggataaaggccatatggaatggcctaactctattgtagtacatgctata
tcagaaaattcatttggcccctataaggttgttcaagaaattggtaaagggcataatcca
gaatggtatataacaaataatggtaactatgtaattgctgttaatggcggatattatgta
tctgatactataaatggcccttggacctatgctaaatttgattttaaccaacgagatcgt
aaaataatagaaaaactttctaatcttacttttgttaaacgcgaggatggttctttttta
atggtttgtcgtggtggaggtatttgggccagtaaggatggtatttcaacatggaatcaa
ttgacggattcaagtgtgtatccaccagtcaaaggtcattttgaagatccgttaatttgg
aaaacaaatgttcaatatcatcttattgtaaatgactggttgggacgtattgcttggcat
atgcgctctaaagacggcatcaattggaaaacagatgctggagaagcgtatttaaccggt
ttttctaattatgataatgggattagggaagattggtttaaatatgagcgcataaaagta
ttacaagataagtttggtagagccactcaagcccactttgctgtgatagatactttaaaa
aaacaggaccgttcaaatgacaatcacagttctaagcaaattgtgatacctctaactgtg
gggaaactaatttcaattatcgataaaaaaacaattaacagtaaaacaacaaaaatcgct
gttttaataaagaaagaagaagggtttgatcctaatactgatatagatatgcaatcatta
aggttcggagcgccagaaaaagtagactttggtatgggatgcaaagcggaaaaaattgaa
agagaaggtgatgatgctttaataacatttacaggggaaggaaacggtattaccgatgat
aattttgcagcaaaattactaggtaaagataatcaagggaatcttctttttggctattca
agattgcctggtgtaagttatttagaagctgctctttctgcacgcaaacctgttatagat
tcattacataatagattaaatgtagctgtagaaaattttggtcagattacttctctagaa
tcaattatatatgtttataaaaaaaatggggaagaaaatatagaaatgggctataatgtt
ataccccctcttaaaccttttgaaaaaacaacaattaacattaacactttaaaaccctta
tcaactttagatgatcaaaaatatctcgtagttataagaaaacgagaagaataa

DBGET integrated database retrieval system