KEGG   Cellulophaga algicola: Celal_0150Help
Entry
Celal_0150        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NARP1
Motif
Other DBs
NCBI-ProteinID: ADV47503
UniProt: E6X754
Position
161991..162479
Genome map
AA seq 162 aa AA seqDB search
MALFDRFKKSKKIEKAATSQHSEQLDEYKRDMITSANLCVSQNSNRFAGLDYSVKSLEQV
DNLLEEAIDFYDEMDEKQKQSLINSVGAYVFEVARKNFGGRYFWYDHLNQPILVTGQPEF
EVSILAFEKVKGRLENGKEDNIPFYFAGYVERVHLKKSGMIV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcactatttgatagatttaaaaagagcaaaaaaattgagaaagcagctacaagccag
cattcagaacaactagatgagtacaagcgagatatgataacgtccgcaaatttatgtgta
tcccaaaactctaacaggtttgccggactagattattccgtaaaaagtctggaacaagta
gacaaccttttagaagaagccattgatttttatgacgaaatggatgaaaaacaaaagcaa
agtttgattaattctgttggcgcttatgtttttgaagttgctcgtaagaattttggtggt
cgatatttttggtatgaccatttaaatcagcctatccttgttacaggtcaaccggagttt
gaggtttcaattctagcctttgaaaaagtaaaaggaagacttgaaaacggaaaagaagat
aatattcctttctattttgctggatatgtagaaagagtacaccttaaaaaatctggaatg
attgtgtaa

DBGET integrated database retrieval system