KEGG   Cellulophaga algicola: Celal_0154Help
Entry
Celal_0154        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47507
UniProt: E6X7R4
Position
165464..165985
Genome map
AA seq 173 aa AA seqDB search
MKLRTEIEPDIHKAETIFPSVLKSITDYTVFVAKNGDEGNIEYQKVVTYLSELTGKNIEE
HDYMIWEYWEGDGEHRESFKIALSEPNVVSDITLPELTEIIKRIVLIEIPEYLKLDFITR
NGFEWELCAYYHQFLKLNFKKYSYGIFNRQKNKDGEWYEPTIEEIVAALWNKK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagaacagaaattgaacccgacatacataaagctgaaacaatatttccaagt
gttttaaaaagtataaccgattacacggtatttgtagctaaaaatggagacgaaggaaat
atagaataccaaaaagtggttacctatctatcagaattaactggtaaaaatattgaggaa
cacgattatatgatttgggaatattgggaaggtgatggagaacacagagaatcctttaaa
atagctttatcagaacctaatgtagtttctgatatcaccctacccgaattaactgaaatt
ataaagcgtatagtactaattgaaattcctgaatatttgaaattagattttattacaaga
aatggatttgaatgggaactgtgtgcttattatcatcagtttctaaaattaaattttaaa
aaatacagctacgggatatttaaccgacaaaaaaataaagatggagaatggtatgaacca
actatagaggaaatcgtagctgcactatggaataaaaaataa

DBGET integrated database retrieval system