KEGG   Cellulophaga algicola: Celal_0155Help
Entry
Celal_0155        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47508
UniProt: E6X7R5
Position
166176..166832
Genome map
AA seq 218 aa AA seqDB search
MRKLIFLVLIGIFSATGYSQTKRANEKIIESAKSDSQNNSYKDIKSLFRWSPLSIFDETT
EGLESSEKEELLKKGESAYWKLMEATNTKLVINHIHNGDRVTLRFFKHKDSLDGVLFAEV
ENGANTSLSSWNYDEESETLQKSNLLHKYTANDFVSKEDKLPDSYHAVVHYSFIDELTIQ
VSLYTWMEKEFENRKISNELFLKWNGENFVEKIERIEQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattaatctttttagtcctaattggcatcttttcagcaacaggttatagtcaa
accaaaagggcaaatgaaaaaataatagaaagcgctaaaagtgattctcaaaataatagt
tataaagacataaaatctctttttcgttggagtcctttatccatttttgatgaaactacc
gaaggtttagaatcttccgaaaaagaagaattacttaaaaagggggaatcggcgtattgg
aaacttatggaagcaactaatacaaagctagtcataaaccacattcataatggggaccgg
gttaccctacgtttttttaagcataaagatagtttagatggtgtattatttgccgaggta
gaaaatggggcgaataccagtttaagttcatggaactatgacgaagagagtgaaaccttg
caaaaaagtaacttacttcataagtacactgcaaatgattttgtaagcaaagaagacaag
ttaccggattcatatcatgctgtagtgcattatagttttattgatgaactaacaatacag
gtatcgctttatacttggatggagaaagagtttgaaaaccgtaaaattagtaatgaacta
tttttaaagtggaatggagaaaatttcgtagagaaaattgaaagaatagagcagtaa

DBGET integrated database retrieval system