KEGG   Cellulophaga algicola: Celal_0158Help
Entry
Celal_0158        CDS       T01404                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K02858  3,4-dihydroxy 2-butanone 4-phosphate synthase [EC:4.1.99.12]
Organism
cao  Cellulophaga algicola
Pathway
cao00740  Riboflavin metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Celal_0158
Enzymes [BR:cao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Celal_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: ADV47510
UniProt: E6X7R7
Position
167942..168604
Genome map
AA seq 220 aa AA seqDB search
MELTAVKTSKMLGSECQEKVEQALTHLKNGNGLILTDDKNRENEGDLIFSAHHMTITDMA
LMIRRCSGIVCLCLTNEKADSLELPYMVKTNTSSFQTPFTISIEAKERVTTGVSAKDRLK
TIQVASVSNAKSTDLAKPGHIFPLRAKRNGVLEREGHTEGSVDLMKLAGLQPEAVLCELM
NDDGTMANTDTITKFAYEHNLKVLSIQDIIHYRKFVRDYK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaacttacagcggtaaaaacatcaaaaatgcttggcagtgaatgtcaagaaaaggta
gaacaagctttaacacatctaaaaaacggaaatggacttattttaactgatgataaaaac
agagaaaatgaaggtgatttaatcttctctgctcatcatatgaccattacagatatggca
cttatgattagaaggtgtagtggtatcgtgtgtctttgtctcaccaatgaaaaagcagac
agccttgagctcccgtatatggtaaagaccaacaccagtagttttcaaacgccgtttact
atttctatagaagcaaaagaaagagttactaccggtgtctctgctaaggataggttaaaa
actattcaagttgctagcgttagtaatgcaaaaagcaccgatttagcaaaaccaggtcat
atttttcctcttagagctaaaaggaacggtgttcttgaaagagaaggccatacggaaggc
agtgtagatttaatgaaactagcaggcttacaacctgaggctgtcctgtgtgagttaatg
aatgatgatggtacaatggccaacacggacactattacaaaatttgcatatgagcataat
ttaaaagtcctgtccattcaggatattattcattatcgtaaatttgtaagagattataaa
taa

DBGET integrated database retrieval system