KEGG   Cellulophaga algicola: Celal_0159Help
Entry
Celal_0159        CDS       T01404                                 

Definition
(GenBank) putative transcriptional regulator, Crp/Fnr family
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding
Motif
Other DBs
NCBI-ProteinID: ADV47511
UniProt: E6X7R8
Position
168605..169180
Genome map
AA seq 191 aa AA seqDB search
MAKYTELTNFIKKNIEIEEEELEIVLSYFKTIKKSKNEILLSNGINSQVSYFVKKGCLRL
YYIDDEGKDITRYIAFENQFATELVSFITNEPAQETIQVIENSELLYITHDDFKHLMHSI
PKWKEFYTIYLEKAYVNNSKRLISFTTLDASERYKQLFKINPNIVRRLPNKIVASYINIS
QETLSRIKSKI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatacactgaactcactaattttataaaaaaaaatattgagattgaagaggaa
gaattagaaattgtcttgtcttattttaaaacaataaaaaaaagcaaaaatgaaatatta
ctttcgaatggcataaatagtcaggtaagttatttcgtaaaaaaaggatgcttaagactt
tattatatagatgatgaagggaaagatattacccgctatattgcttttgaaaatcagttt
gccacagaactagttagttttatcaccaatgaacctgcacaagaaactattcaggttata
gaaaacagtgagttactgtacattactcatgatgattttaaacatttgatgcatagtatt
cccaaatggaaagaattttatacgatctatttggaaaaagcctatgtaaataattcaaag
aggctcatctcctttacgacgctagatgcttcagaaaggtataaacagttatttaaaata
aaccctaatattgtaaggcgcttacccaacaaaatagtagcgtcttacattaatatatcc
caagaaaccttgagtagaataaaatctaagatttga

DBGET integrated database retrieval system