KEGG   Cellulophaga algicola: Celal_0161Help
Entry
Celal_0161        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3546
Motif
Other DBs
NCBI-ProteinID: ADV47512
UniProt: E6X7R9
Position
170938..171471
Genome map
AA seq 177 aa AA seqDB search
MDEYNYHKNFYYPLLIDLRNEINSSEYETNSKKYLDFFLSGIVEFKNRKNKEGEWICSYS
PLRNERIDKAIFVHIPFTRKLNDFLREALNEEKMISKFSPKLTETDKQSSSNQQIRPTSR
FLNFEKSDLVDFYNLIDINNLKQLTLELFEFIEHEIVYCENYIGKIDDTQKDLVDLI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtataattatcacaagaatttttattatccactattaattgatttgagaaat
gaaattaattcaagtgaatatgaaacgaacagtaaaaaatatttagattttttcctcagt
ggaattgttgaatttaaaaatagaaaaaataaggaaggagaatggatctgttcatattca
ccgttaagaaacgaaagaatagataaagcaatatttgttcatataccttttactaggaaa
ctcaatgattttttacgtgaagcactcaatgaggaaaaaatgatttcaaaatttagtcca
aaactaactgagacagacaaacagtcatcatcaaaccagcaaattcgtccaacatcacgt
ttccttaactttgaaaaatcagatttagttgatttttataatttaatcgacatcaacaat
ttaaaacaattaactctagaattgtttgaatttatcgaacatgagattgtctattgtgaa
aattatattgggaaaatagatgatacacaaaaagacttggtggatttaatttag

DBGET integrated database retrieval system