KEGG   Cellulophaga algicola: Celal_0165Help
Entry
Celal_0165        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV47516
UniProt: E6X7S3
Position
174801..175157
Genome map
AA seq 118 aa AA seqDB search
MEVIEENPLFKMMNEMSASEEETAIADYGEFGYEASNPIPVKSELDISTYLGRLRTIAGK
KVAYKKLGITNTPLIETPIAIYKITLHGTLLATLYISANQFINSERAPKNFELAALPH
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaattgaggaaaatccgctatttaaaatgatgaacgaaatgtccgcatctgaa
gaagaaactgccatagctgattatggagaatttgggtacgaagcatcgaaccctattcct
gtaaaatctgaattagacatctctacgtatttaggaagattaagaactatagcgggtaaa
aaagttgcgtataaaaaactaggtatcaccaatacacctcttatagaaactccgattgct
atatataaaataacgctacatggcaccttacttgctacgttatatataagtgcaaatcag
tttataaactctgagcgcgcaccaaaaaactttgaattggccgcactaccccattaa

DBGET integrated database retrieval system