KEGG   Cellulophaga algicola: Celal_0167Help
Entry
Celal_0167        CDS       T01404                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 TPR_2 Hydrolase_4 TPR_1 TPR_14 DUF2222 TPR_16 TPR_11 ANAPC3 TPR_12 TPR_8 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ADV47518
UniProt: E6X7S5
Position
176345..177487
Genome map
AA seq 380 aa AA seqDB search
MKHQYAISSLFFILSFYICAQSVDKHVDMGEYTMHFKIIKGEGTPILFEAGGGDDSTVWD
PILQKIHDATGATLISYDRSGFGKSELNPKLKNEADFGIENGIKELEAGLSKLGYTDKIM
LVSHSYGGLYNLLYARKHPKKVTAVVLIDVTLSDFWNEELLTMRDMNIDISAIPKPSGDY
YMNANFNKIMRDVRGLKFPESMPILNIFPENSFPGFPEILSNRWRELHQELGAQNQNITN
SIAKGSSHGVFQDNPALVINAINKMYAETLDKNQQNIVLKKALAIAMELAIETKSTNRSE
NDLIALGYSFLGNAELDKALEVFKVNIALFPESSNAYDSYGEALLIADQKPEAIEMYTKS
IELDPNNENAKAVLLKMKEE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcagtatgctatcagctcattattttttattttatcgttctatatctgtgca
caaagtgtagataaacatgtagatatgggcgaatatactatgcattttaaaataataaaa
ggagaaggtacgccaatactttttgaagctggcggtggtgatgatagtacagtttgggat
cctattttacaaaaaattcatgacgctacgggagcaacgcttattagctatgacagatct
ggatttggaaaaagtgaactcaacccgaagctgaaaaatgaagctgatttcggaatcgag
aatggcattaaagaactagaagctggtctttctaagttgggttacactgataaaattatg
ttggtttctcattcttatggcggactctacaatttgttatacgcacgtaaacatcctaaa
aaagttactgctgtagttttaatagatgttacacttagtgatttctggaatgaggaatta
ttgaccatgagagatatgaatattgacataagtgctattcctaagccttctggtgactat
tatatgaatgcaaattttaataaaataatgcgcgatgtaagaggtttaaaatttcctgaa
agcatgcctatattaaatatttttcctgaaaactcctttccaggttttcctgagatactt
tctaatcgatggagagaactacaccaagaactaggtgctcaaaaccaaaatataacgaat
agcattgctaaaggaagcagtcatggagtatttcaagataatcctgcactcgtaatcaac
gcaattaataaaatgtatgcagaaacattagacaaaaatcagcaaaacatagtattgaaa
aaagctttagctattgccatggaattagctattgaaacaaaaagtaccaatcgttcagaa
aatgatttaattgcattagggtattcatttttaggaaatgcggaattagataaggcttta
gaggtttttaaagtgaatattgcattatttccggagagttctaatgcatatgatagttat
ggagaagctttattgatagctgatcaaaaaccagaagctattgaaatgtataccaaatct
attgaattggatcctaataatgaaaatgcaaaagcagtattgcttaaaatgaaagaagaa
taa

DBGET integrated database retrieval system