KEGG   Cellulophaga algicola: Celal_0170Help
Entry
Celal_0170        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2570 DUF3549
Motif
Other DBs
NCBI-ProteinID: ADV47521
UniProt: E6X7S8
Position
178560..179456
Genome map
AA seq 298 aa AA seqDB search
MIKKISVALFILCLLSCQSKATKAEISQLKQEAKNQKILIDSLQNFNQGLIGFQDYFKNE
RENYYLDKDKLLFLLEGTSWFSLNNKKLLRYFFDDFNLKEYDVFRGIENSSVLYPSSDDV
LDIFNSESSFVIHMVSKIDRSPAALEKLCTPELKEMTYSLLKENDLYKASGAYAGVKALL
LSYEDVENDKEFLATIHKIATNATNDYEEGNKAFKNAISAKTSDEIRAVLSDENYTTYYE
NTRSNQDSRLIEVYCFWARRHKEGNMEFTYTFLKELHENVANEFVTTDAYSSIDGPNS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagataagtgtagcactatttattttatgcctactatcctgccagtcaaaa
gcaaccaaagctgaaattagccaactaaaacaagaagccaaaaaccaaaaaatcttaata
gactcgctacagaattttaatcagggcttgattgggtttcaagattattttaaaaacgaa
agagaaaattattatttagataaagataagctcttatttctactagaaggtacctcatgg
ttttcattgaacaataaaaaattactgcgatacttttttgatgattttaacctaaaagaa
tatgatgtattcagaggtattgaaaatagttctgtactttaccctagctctgatgatgtt
ctagatatatttaattcggaatctagttttgtgatccatatggtttcaaaaatagataga
agtccggctgcactagaaaaactatgtactccggaacttaaagaaatgacatattcttta
ttaaaagaaaacgacctatacaaagcctctggtgcgtatgcaggcgtaaaagctctactg
ctgtcttatgaggatgtagaaaatgacaaagaatttctagctactattcataaaatagcc
acgaatgctactaatgattatgaagaaggtaacaaagcctttaaaaatgcaatttcagca
aaaacttctgatgaaattagagctgttttaagtgacgaaaattacactacgtattatgaa
aacactagatctaaccaagattcaagacttattgaagtctattgtttttgggcaagacgt
cataaagaaggaaatatggaatttacgtatacctttttaaaagaattgcatgaaaatgtg
gccaatgagtttgtgactactgacgcctattcttctattgacggacctaattcttaa

DBGET integrated database retrieval system