KEGG   Cellulophaga algicola: Celal_0332Help
Entry
Celal_0332        CDS       T01404                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cao  Cellulophaga algicola
Pathway
cao00020  Citrate cycle (TCA cycle)
cao00640  Propanoate metabolism
cao00660  C5-Branched dibasic acid metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
Module
cao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_0332
   00640 Propanoate metabolism
    Celal_0332
   00660 C5-Branched dibasic acid metabolism
    Celal_0332
Enzymes [BR:cao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Celal_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADV47676
UniProt: E6X9D7
Position
complement(388969..390159)
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQGKEILASFGVRIQRGIVAHTAKEAVDAAKQLTAETGTGWHVIKAQVHAGGRGK
GGGVKLAKNLKEVEEIAGQIIGMTLITPQTSAEGKKVHQILVAEDVYYPGASETKEFYMS
VLLNRGTGRNMIMYSTEGGMDIEEVAENTPHLIFTEEIDPGTGLLPFQARKIAFNLGLSG
TAFKEMTKFVASLYKAYDESDSSMFEINPVLKTSDDKIMAVDAKVSIDDNALFRRKQYAE
MRDLREENAIEVEAGALGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TADAARVEAAFKIILKDPAVKAILINIFGGIVRCDRVAQGVIDAYKNMGTINVPIIVRLQ
GTNADLAKELIDNSGLDVQSAVQFQEAADKVKAVLG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgaatatcaaggaaaagaaattttagcaagttttggggtacgtatccaa
agaggaattgtagctcatactgcaaaagaagctgtagatgctgcaaagcaattaacagca
gaaacagggactggatggcacgttataaaagcgcaagttcacgctggtggccgcggaaaa
ggtggtggagttaaattagctaagaatttaaaagaggttgaagaaattgcaggacaaatc
attggaatgactttgattacgcctcaaacttctgctgaaggtaaaaaggtacaccaaata
ttagttgcagaggatgtttattatccaggagcaagtgaaactaaagagttttacatgtct
gttttattaaaccgtggtactggtagaaacatgattatgtattctacagaaggtggtatg
gatatcgaagaagtagctgaaaatacacctcatttaatttttacagaagagattgatcct
ggaacagggttattgccttttcaagcacgtaagattgcctttaatttaggattatctggt
actgcttttaaagaaatgacaaagttcgtagcatctttatataaagcatatgatgaaagt
gattcaagtatgtttgaaatcaacccagttttaaaaacttcggatgataaaataatggct
gtagatgctaaggtatctatagatgataatgcactttttagaagaaaacaatatgcagaa
atgcgtgatcttcgtgaagaaaatgcaattgaagttgaagctggtgctttaggtttaaat
tacgtagatcttgatggtaacgttgggtgcatggtaaacggagctggtttagcaatggca
actatggatttaattaagcaagcaggtggtgagccagctaactttttagatgttggtggt
actgctgatgctgctcgtgtagaggctgcttttaaaattatattaaaagatcctgcagta
aaagcaattttgattaatatcttcggtggtatcgttcgttgtgatcgtgttgctcagggt
gttattgatgcatataagaatatgggaactataaacgtgcctattattgttcgtttacaa
ggtacaaatgcagatttagcaaaagaattaattgataattctggtttagatgtacagtct
gctgtacaattccaagaagctgcagataaagtaaaagctgtattgggttaa

DBGET integrated database retrieval system