KEGG   Cellulophaga algicola: Celal_0501Help
Entry
Celal_0501        CDS       T01404                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cao  Cellulophaga algicola
Pathway
cao00790  Folate biosynthesis
cao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celal_0501
Enzymes [BR:cao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Celal_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ADV47840
UniProt: E6XBK5
Position
591541..592221
Genome map
AA seq 226 aa AA seqDB search
MKIDSTLEDQFEEIGDNHVSTSEDTPLLDNAFDLSDEEKIVKIKANVSEIMETLGLDLTD
DSLKGTPNRVAKMFVNEIFSGLHPDKKPKSSTFDNKYKYGEMLVEKNITLYSTCEHHFLP
IVGRAHVAYISNGTVVGLSKMNRIVDYFAKRPQVQERLNIQIVRELQKVLNTEDVACIID
AKHLCVNSRGIRDIESSTVTAEYGGKFKEEATRKEFLNFIQLETRF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgacagtacattagaagatcaatttgaagaaattggagataatcatgtttca
acttctgaagataccccattacttgacaatgcttttgatttgagtgatgaagaaaaaata
gtaaagataaaagctaatgtttctgaaattatggaaacccttggcttagaccttactgat
gacagtttaaaaggaactcctaatcgagtagccaaaatgttcgttaacgaaatattttct
ggcttacaccctgacaaaaaaccaaaatcttctacgtttgataacaaatacaagtatgga
gaaatgttggtggaaaaaaacataacactttacagtacttgtgagcaccattttttacct
attgttggtagagcacatgtagcttacatatctaatggtaccgttgttgggctttctaaa
atgaaccgtatcgtagattattttgcaaaaagaccacaagtacaagagcgcttgaatatt
caaattgtaagagaattacaaaaagtattaaataccgaagatgttgcctgtattattgat
gcaaaacacctttgtgttaattctaggggtatccgcgatattgaaagcagtactgttacg
gctgaatatggtggaaaattcaaagaagaagcaacacgtaaagagtttttaaattttatt
cagttagaaacaaggttttaa

DBGET integrated database retrieval system