KEGG   Cellulophaga algicola: Celal_0530Help
Entry
Celal_0530        CDS       T01404                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00520  Amino sugar and nucleotide sugar metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
Module
cao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_0530
   00520 Amino sugar and nucleotide sugar metabolism
    Celal_0530
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Celal_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADV47869
UniProt: E6XBN4
Position
628879..629622
Genome map
AA seq 247 aa AA seqDB search
MTLLGIDIGGSGIKGALVNTVTGELLTERFRIETPKSGKPEEIAEIFAKIVKHFKYQGPI
GCGFPTIIKNGVCKAHGNLSKKWLGVNAEELFSDYTGLPVTVINDADAAGYATMNYGIGK
GKKGLVIMITIGTGLGSGAFFNGELLPNFELGQIPYKKHDKFEHYAAASIKEKEKLSYKK
WGKRFNKFLKYVEFIVSPDLIIIGGGTSKDFDEFKEYIKIDTPVIAAELQNYAGIIGAAT
AAFKKKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactttattaggaattgatattggaggctcaggaattaaaggggcattagtgaatacc
gttacaggcgagctactaaccgaacgtttcagaatagaaactccaaaatcaggaaaaccc
gaagaaatagcagaaatatttgctaaaattgttaaacattttaaatatcaaggtcctatt
ggttgcggtttccctactattattaaaaatggagtttgtaaagctcatgggaatttaagt
aaaaaatggctaggtgtaaacgcagaggaactttttagcgattacacaggtttacctgtt
accgtaatcaatgatgcagatgcagcaggatatgccaccatgaactatggtataggaaaa
ggaaaaaaaggcttggtaattatgattactattggcactggtttaggcagtggcgctttt
tttaatggagaattgttgcccaattttgaattaggtcaaattccttataaaaagcatgat
aaatttgaacattatgctgccgcctccattaaagaaaaagaaaaattgagctataaaaaa
tgggggaaaagatttaataaattcttaaagtatgttgagtttattgtttcaccagattta
ataatcataggcggagggacttctaaggattttgatgaatttaaagaatacataaaaatt
gatacacctgtgattgcagccgaattacaaaactatgcaggaatcattggcgcagctact
gctgcatttaaaaagaaaaaataa

DBGET integrated database retrieval system