KEGG   Cellulophaga algicola: Celal_2257Help
Entry
Celal_2257        CDS       T01404                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
cao  Cellulophaga algicola
Brite
KEGG Orthology (KO) [BR:cao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Celal_2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ADV49550
UniProt: E6X6L2
Position
complement(2573931..2574326)
Genome map
AA seq 131 aa AA seqDB search
MKAMTTQITKGIKISVSTSFEGTFFKNYKTHYAFGYTITIENQSKDSVQLTSRHWKIYDS
LNELEVLDGEGVIGKKPVILPGESHTYSSGCLLTSTIGAMKGHYNMVNFTTNEKFRVYIP
TFKFSTPFTLN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcaatgacaactcagataacaaaagggataaaaatttctgtaagcaccagtttt
gaaggtacgttttttaaaaattataaaacgcactacgcctttggatatactattactata
gaaaaccaaagcaaggactctgtacaacttacctcccgtcattggaaaatatacgactcc
ctcaatgaattagaggtattagatggtgaaggcgtaataggaaagaaacctgttatcctt
ccaggagaatctcacacctatagttctggatgtctactaacctctaccattggtgcaatg
aaaggtcattataatatggtcaatttcacaaccaatgaaaagtttagagtatacattccc
acttttaaattcagtactccgtttacattgaactaa

DBGET integrated database retrieval system