KEGG   Cellulophaga algicola: Celal_2517Help
Entry
Celal_2517        CDS       T01404                                 

Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cao  Cellulophaga algicola
Pathway
cao00620  Pyruvate metabolism
cao00630  Glyoxylate and dicarboxylate metabolism
cao01100  Metabolic pathways
cao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celal_2517
   00630 Glyoxylate and dicarboxylate metabolism
    Celal_2517
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Celal_2517
    1.2.1.22  lactaldehyde dehydrogenase
     Celal_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADV49804
UniProt: E6X9N4
Position
complement(2903375..2904829)
Genome map
AA seq 484 aa AA seqDB search
MSSIQEYKLFINGEWRTSTSGETIAIVNPSTEEIVARVQNGTTEEAIEALQAAEKAQKEW
KKLPAKERADLLYKFSNEIKANSEYLAQLLVKEQGKLLKVARFEVAVASSFIEYACEGAR
RIEGDIIPSDNPNEQIWIQKIPRGVIVAITAWNFPLALAARKLGPALIAGNSIVIKPTSE
TPLATLELGTIANKVGIPAGVINILTGPGRAMGNALVESPITKMVTMTGSTPVGQQIARN
AAQNLTHVQLELGGKAPFIVFEDADIDAAVDAALHSRFDNCGQVCTCNERMYLQESIYDV
FMEKFLKKVSEIKVGDPMLEDTDMGPKVNAAELKAMEHLVAVSVQEGATIAAGGKKPVGT
QFEKGYWFEPTVLTNVTQDMTIVHEESFGPILPVLKFKTFDEVIGYANDSEYGLAAMVFT
NDMNTIMKCNDELEYGEIYVNRGHGEQHQGFHNGYKLSGSGGEDGKYGFEQYMEKKTFYI
RHKA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatacaagaatataagctcttcattaatggagaatggagaacctcaacatca
ggagaaactattgctattgtaaacccttctacagaagaaatcgtggcacgcgttcaaaat
ggaactacagaagaagctatcgaagcattgcaagccgctgaaaaagcgcaaaaagaatgg
aaaaaattaccggcaaaagaaagagcagatcttctatataagttttctaatgagattaaa
gctaattctgaatatttagcgcaattactggttaaagaacagggaaaactacttaaagta
gcgagatttgaagttgcagtagcctcttcttttatagaatatgcttgtgaaggtgctcgt
agaattgaaggtgatattattccttctgataatcctaacgaacaaatttggattcaaaaa
atacctagaggagttattgttgctattaccgcgtggaattttccattggccttagctgct
agaaaattgggtccagcattaattgcaggaaatagtatcgttataaaaccaacttcagaa
acaccattagccacacttgagttaggaactattgccaataaagtaggtatccctgcagga
gttatcaacattcttacaggaccaggtagagctatgggtaatgcgttagttgaaagccct
attaccaaaatggtcaccatgactggctctactcctgtaggacaacaaattgctaggaat
gccgctcaaaatttaacccatgttcaattagaattaggtggtaaagcgccctttattgta
tttgaggatgccgatattgatgctgctgtagacgcggctttgcattctcgttttgataat
tgcggccaagtatgtacttgtaatgaacgcatgtatttacaggaatctatctatgatgta
tttatggagaaattccttaaaaaagtcagtgaaataaaagtgggtgacccaatgttagaa
gatactgatatgggacctaaagtaaatgccgcagagcttaaagctatggagcatttggtt
gccgttagtgtacaagaaggcgcaacaattgctgcaggtggaaaaaaaccagtaggtact
caatttgaaaagggatattggtttgagccaacggtcttaaccaatgtaacccaagatatg
accattgttcatgaagaatcttttggtcctattctacccgtattaaaatttaaaactttt
gacgaagttattgggtatgcgaacgattctgaatatggtttggctgcaatggtttttact
aatgacatgaataccattatgaaatgtaatgatgaattagaatacggtgaaatatatgta
aatcgtggtcatggtgagcagcaccaagggttccataatggctacaaattatctggttct
ggtggtgaagatggcaagtatggctttgaacaatatatggagaagaaaacattttacatc
agacacaaagcttag

DBGET integrated database retrieval system