KEGG   Cellulophaga algicola: Celal_2647Help
Entry
Celal_2647        CDS       T01404                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00052  Galactose metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
Module
cao_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_2647
   00052 Galactose metabolism
    Celal_2647
Enzymes [BR:cao01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Celal_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DPCD
Motif
Other DBs
NCBI-ProteinID: ADV49932
UniProt: E6XB68
Position
complement(3060227..3061216)
Genome map
AA seq 329 aa AA seqDB search
MVYNCCYLKDDSIIKVLQKSLNLFINFSALIQNTIKNNKIELTVLDFGAIIQKIIVKDKN
GNPTNMVVGFEQPKDYLDNPMFLGACIGRYAGRISKGEFTLDKKIYPIQEEKGVHLHGGS
AGFNKKYFKVDEVNHGGNPFIKLSYISEHLEEGYPGTLKVSVTYTLEDNALIVTHEATTD
QKTVVNLTNHSYFKLDNTAEINHYDLQLDCTKILDTYDNLIPTGKLTEVAHTKYDFLENK
KINTTRLDTPFVIDKRKEICASVHSAISGITLEVTTNQAAVVIYTPETTGSICFETQNYP
DAPNQPNFPSSVLNKGEKYFNQSIFRFKA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtttataattgttgttaccttaaagacgatagcattattaaagtgttgcaaaaaagt
ttaaatttgtttataaatttttcagctttgattcaaaatactattaaaaataacaagatt
gaacttactgttctagattttggcgccattattcaaaagattattgtaaaagataaaaac
ggcaatcctaccaatatggtcgttggttttgaacaacctaaagactacttagacaatcct
atgtttttaggtgcgtgtattgggcgttatgcaggaagaatctctaaaggagaatttact
cttgataaaaaaatataccctatacaagaagaaaaaggtgttcacctacatggtggttcc
gcaggttttaataagaagtattttaaagttgatgaagttaatcacggaggtaatccattt
ataaaactttcatatataagtgaacacctggaagaaggctatcctggtactttaaaagta
agcgttacgtatactttagaagacaatgctttaattgttacccatgaagccacaactgat
caaaaaacagtagttaatttaacaaatcactcatactttaaattagacaacacagccgaa
ataaaccattacgacttacaattagattgtactaaaattctagatacgtatgacaacctt
atccctacggggaaactaactgaagttgcgcataccaagtatgatttcttagaaaataaa
aaaataaacacaacacgcctagatactccttttgtaattgataagcgtaaagaaatttgc
gcatcagtacattctgcaatttccggaattactttagaagtaacaaccaaccaagctgca
gtagtcatttacacgccagaaactacaggatctatctgttttgaaacacaaaactatcct
gatgctcctaatcaacccaatttcccgtcgagtgttttaaacaaaggagaaaaatatttt
aaccaatctatatttagattcaaagcataa

DBGET integrated database retrieval system