KEGG   Cellulophaga algicola: Celal_2874Help
Entry
Celal_2874        CDS       T01404                                 

Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cao  Cellulophaga algicola
Pathway
cao00500  Starch and sucrose metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celal_2874
Enzymes [BR:cao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Celal_2874
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADV50152
UniProt: E6XDL0
Position
3313899..3315794
Genome map
AA seq 631 aa AA seqDB search
MPNVEVHSLFTEFDINLFKAGKHFQLYEKLGSHLITLNGIKGTYFSVWAPTANSVSVIGD
FNSWQVGEHELNVRWDDSGIWEGFIPEIEKGALYKYSIRSNNQGIRTEKADPFARYCEKP
PKTGSVVWDGDYSWQDKAWMGYRKDKNGLDKPYSVYEVHLGSWKRKEDNQFLSYLELAEE
LVQYVKEMNFTHVEFMPIMEYPYDPSWGYQLTGFFAPTSRFGNPEEFKVLVDKLHQNDIG
VILDWVPSHFPEDAHGLGFFDGSHLYEHPDRRKGYHPDWKSLIFNYGRNEVRAFLISNAM
FWMDQFHVDALRVDAVASMIYLDYSREEGEWEPNIYGNNENLEAISFLKEMNQQLYASFD
GIQTIAEESTAFSGVSRPVDLGGLGFGMKWMMGWMHDTLEYFKKEAIYRKHHQNDITFSM
TYAFSENFMLPFSHDEVVYGKQSLLNRMPGDEWQRFANLRLLFGYMFTHPGAKLIFMGGE
FGQSSEWDFQKSLDWHLTQYNFHSGIQETVKDLNTIYKNYPALYEKQFSTEGFQWIDYGD
GENSVLAYIRKGHDAKNDLLVICNFTPVQRDNYRLGVPKATKLKEIFNSDAEKYGGSGVL
NAKIKTEKIASHTYKNSIEITLPPLGIVILQ
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacgtagaagtacatagcctatttacagaatttgatataaatctatttaaagcg
ggtaaacattttcagttgtatgaaaaattagggtcacaccttattactttaaatggaatt
aaaggcacctatttttcagtgtgggctcccacagcaaattccgttagtgttattggcgat
tttaattcatggcaagtaggagagcatgagcttaacgtacgttgggatgatagtggtatt
tgggaaggttttattccagaaatagaaaaaggcgctctttataagtatagtatcaggtct
aataaccaaggtattagaacagagaaagcagatccttttgcgcgctattgcgaaaaacca
cccaaaactggttctgttgtttgggatggtgattattcgtggcaagacaaggcgtggatg
ggttaccgtaaagataaaaatggtttagataaaccgtattccgtgtatgaagtgcatttg
gggtcttggaaacgaaaagaagataatcagtttttgagttatttagaattggcagaggag
ttagtgcagtatgtaaaagaaatgaattttacacatgtagaatttatgccgattatggaa
tacccgtatgacccttcttgggggtaccaattaacaggcttttttgcaccaacgtctaga
tttggaaacccagaagagtttaaagttttggtagataaattacatcagaatgatattggg
gttatattagattgggttccatcacattttcctgaagatgcgcatggactaggatttttt
gatggctcacatttatatgagcacccggatagacgtaaaggatatcatcctgattggaaa
agtttaattttcaattatggtagaaatgaggttcgtgcatttctaattagcaatgctatg
ttctggatggatcagtttcatgtagatgccctacgggtagatgctgttgcttcaatgatt
tacctagattattctagggaagaaggcgagtgggagccaaatatttatggaaataatgaa
aatttagaggcaatttcatttttaaaagaaatgaatcagcaattatatgcaagttttgac
ggtatacagaccatagcggaagaatctactgctttttcaggggtgtcacgacctgtagat
ttaggtggtttaggctttgggatgaaatggatgatgggttggatgcatgatactttagag
tattttaaaaaagaagctatctatagaaaacaccatcagaatgatattacgtttagtatg
acgtatgccttctctgagaattttatgcttcctttttcgcatgatgaagtggtgtatggg
aaacaatcgcttttaaatagaatgccaggagatgagtggcagcgttttgctaatttgcgt
ttgctatttgggtacatgtttacacacccaggagcaaagctaatttttatgggaggagag
tttggacaatcttctgaatgggatttccagaaaagtttagattggcatttgacgcaatat
aattttcattcaggaatacaagaaactgtaaaagatttaaataccatttataaaaactat
ccggcattgtatgaaaagcaatttagtacagaaggtttccaatggatagattatggtgat
ggtgaaaattctgtactggcatacatccgaaaaggacatgatgctaaaaacgatttactt
gtaatctgtaatttcactccagtacaaagagataactatagattaggggttccaaaagca
actaaactaaaagaaatttttaatagtgatgctgaaaaatatggaggctcaggagtgtta
aatgcgaagatcaaaacagaaaaaatagcgagtcatacatataagaattccatagaaata
acattgcctccgctcggaattgttattttacaataa

DBGET integrated database retrieval system