KEGG   Cellulophaga algicola: Celal_2962Help
Entry
Celal_2962        CDS       T01404                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00260  Glycine, serine and threonine metabolism
cao00680  Methane metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
cao01230  Biosynthesis of amino acids
Module
cao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cao_M00002  Glycolysis, core module involving three-carbon compounds
cao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_2962
  Energy metabolism
   00680 Methane metabolism
    Celal_2962
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_2962
Enzymes [BR:cao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Celal_2962
Membrane trafficking [BR:cao04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Celal_2962
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Celal_2962
  Exosomal proteins of melanoma cells
   Celal_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADV50238
UniProt: E6XEE8
Position
complement(3412327..3413016)
Genome map
AA seq 229 aa AA seqDB search
MGKLILVRHGKSLWNVKNVFTGWTDIDLATEGINEAETAGQLIKSNLIDIDICFSSYLKR
AIRTAWILLETAEMMHVDCRYSWKLNERHYGDWQGKNKDEVLEEVGEEFFLSVRRGYETP
PPSLSIYDKRNPEFDANYKALDPSILPLAESLKDTSKRVVNYFFEAIAPELAKGKNVLIS
AHGNSLRALIEFLEHISSDEIANVEVATGVPHLYEFDEKLNVIDHYQLK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattgatattggttaggcatggcaaaagcttatggaacgtaaaaaacgtattt
acgggatggacggacattgacttggctacagaaggaattaatgaagcagagacagctggg
caacttatcaaatcaaatctcatagatattgatatttgcttttcctcctatctaaaaaga
gctattagaacagcgtggattttattggaaacggcagaaatgatgcacgtagactgccgc
tatagctggaagctgaatgaaagacattatggtgattggcaaggaaaaaataaagatgaa
gttctagaagaagtaggcgaagaattctttttgagcgttagaagaggttatgaaacccct
cctcctagcctttcaatttatgataaaagaaaccccgaatttgatgcgaactacaaggct
ttagatccatcaattttacctctggctgaatcactgaaagatacttcaaaaagagtggta
aattatttttttgaagctattgctcctgagcttgccaaaggaaaaaacgtattgatctct
gcgcatggcaattcattacgcgcactcatagaattcttagagcatatctcatctgacgaa
atagctaacgtagaagtagctactggggttcctcatttgtatgaatttgatgaaaaatta
aacgtaatagaccattatcaattaaaataa

DBGET integrated database retrieval system