KEGG   Cellulophaga algicola: Celal_3659Help
Entry
Celal_3659        CDS       T01404                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00053  Ascorbate and aldarate metabolism
cao00071  Fatty acid degradation
cao00280  Valine, leucine and isoleucine degradation
cao00310  Lysine degradation
cao00330  Arginine and proline metabolism
cao00340  Histidine metabolism
cao00380  Tryptophan metabolism
cao00410  beta-Alanine metabolism
cao00561  Glycerolipid metabolism
cao00620  Pyruvate metabolism
cao00625  Chloroalkane and chloroalkene degradation
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
Module
cao_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_3659
   00053 Ascorbate and aldarate metabolism
    Celal_3659
   00620 Pyruvate metabolism
    Celal_3659
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Celal_3659
   00561 Glycerolipid metabolism
    Celal_3659
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Celal_3659
   00310 Lysine degradation
    Celal_3659
   00330 Arginine and proline metabolism
    Celal_3659
   00340 Histidine metabolism
    Celal_3659
   00380 Tryptophan metabolism
    Celal_3659
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Celal_3659
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Celal_3659
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Celal_3659
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Celal_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh FAM86
Motif
Other DBs
NCBI-ProteinID: ADV50914
UniProt: E6X9V3
Position
complement(4186084..4187451)
Genome map
AA seq 455 aa AA seqDB search
MQQIVENQREFFHTQHTKSISFRKEYLKKLMSAIEKYEDEICDAIFLDFKKPKFETILTE
TQFVLAELNTAIKKLNSWAKPARKSTSWANWPSSDYIYKEPYGTVLIIAPWNYPFQLAIA
PLIGALAAGNTAVIKPSEITPNTSEIIVKIITEVFPENYVTVVEGGVEASQNLLAQKWDY
IFFTGSSKVGQIVYKSAAKYLTPVTLELGGKNPTIVDATANIAVAARRIAWGKFLNAGQT
CIATDYILVHKTVKEKLIHELIETIKSFYSSEIASSPDFARTVSAKHFEGLLAMLEGEKI
IFGGENNPVDNYLAPTLLDESKMESKVMEGEIFGPILPIISYETLADIDTYMSNYEKPLA
TYVFSADKKFQDTILSKYSFGGGAINDTVIHIANKNLPFGGVGASGIGAYHGKISFDTFS
HSKAILKKGTWLDIPLRYPPYKLSLDFAKKLKKMF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatagtagaaaatcaacgagaatttttccatacgcaacacaccaagtccatt
tcttttagaaaagagtatttaaagaagttgatgagtgctattgaaaaatatgaggatgaa
atttgtgatgcaatctttttagattttaaaaaaccaaagtttgaaaccatacttacggaa
actcaatttgttttagcagaattaaatacagctataaaaaaattgaattcatgggccaaa
cctgcccgtaaaagtacttcatgggccaattggccttcttcagattatatttataaagaa
ccctatggtacggtattgataattgcaccgtggaattatccttttcaattagctattgcc
ccattaattggtgcactagctgcaggaaatactgcggttattaaaccctcagaaattact
cctaatacttcagaaattatagttaaaattattaccgaagtgtttcctgaaaattatgtt
acagtcgtagaaggtggcgttgaagcttctcaaaatttactcgcacaaaaatgggattat
attttctttacaggaagttctaaggtagggcagattgtctataaaagcgcagcaaaatac
ttgactccagtaactttagaattaggaggaaaaaaccccactatagtagatgcaacagct
aacattgcggtagcagcacgaagaattgcatggggtaaatttttaaacgcaggacaaaca
tgtattgccactgattatattttggtacataagacagtaaaagaaaaacttatccacgaa
ttgattgaaacgataaaaagcttctatagttcagaaattgcatcttctccagattttgcg
cggaccgttagtgctaagcattttgaaggattattagccatgttagaaggcgagaaaatt
atttttggaggagaaaataatccagtagataactacctagcacctactcttttagacgaa
tcaaaaatggagagtaaggtgatggaaggagaaatatttggccctatactacctataata
tcctatgaaaccctagcagatattgatacttatatgtcaaattatgagaaacctttagcg
acctatgtatttagtgccgataaaaaatttcaggatacaattttaagcaagtatagtttt
ggtggtggcgctatcaatgatactgtaatccatattgcaaataaaaaccttccttttggg
ggtgttggcgcaagtggcattggagcctatcatggtaaaatatcctttgatacattttca
cactcaaaagctatcctcaaaaaagggacttggttagatattccattacgttaccctcct
tataagttgtctttagattttgctaaaaagcttaaaaaaatgttttaa

DBGET integrated database retrieval system