KEGG   Cellulophaga algicola: Celal_3740
Entry
Celal_3740        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADV50989
UniProt: E6XAM7
Position
complement(4280786..4282648)
AA seq 620 aa
MKSLSKEEIKERLIRRAADTWGMDEMEIEYSLDPIISILFDACSHEFERISDTIKSSRTR
ITERLVDLLTPQVSVTARPAHAVMHALPIDSNLNINERSEFYHRKRMPIFRENGKNDFED
FFFAPAGAFKLSNCSLDYIAYPEKIASHKAHRNIPFISKDNFVGTPDGSSIYLGIKPDEE
TSSIQDLLCYFDLLNFSQKNVLTHQLGLSKWSLNGTPLEVVNGYNELEFAGQDLNTYINE
SIQSKIKFYENYVKEFYQEHFYTITDTISVKDNLKDYPEDFENFLSEKDLKEFNTPLLWI
KISFSSIVSSKMLDNLHCHINCFPVLNKKRHETNRRLKSYFNILPLEIDGDYFFDVQDII
GDSGNTYFIQDRKKEDTSTSTQAYLRFGGVSRFDERDASELLNYTIDLLKEDSIAFNAMN
DDFINTNLKDLKQIISRIDQQIELRDFTKNKIPYLVINKNSINKNKDQFVFTNYWSTAGD
KANKINPYVQLVQYSGTAFLPNSLTFITGTIGGKDEPSASEKIYAYREHILSKGKIITRQ
DIIQHCFGIFKDSIKKVTIEKGVVVALEEGIGYTPTTDVYITKHEDAVYDEESWEHLKKE
VLIGLQSRSANVLPFRIFYS
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaaatcattaagtaaagaagaaataaaagaacggttaattagaagggctgcggatacc
tggggaatggatgaaatggaaattgaatattccttagaccctattattagtattcttttt
gacgcttgctcacatgagtttgaacgtatttctgatactataaaatctagtagaaccaga
attacggagcgtttagtagatttgctaacaccgcaagtatcggtaactgcaagaccagca
catgctgtgatgcatgccttacctatagatagtaatttaaatattaatgaacgttcagag
ttttaccaccgtaaaagaatgccaatttttagggagaatggtaaaaacgattttgaagat
tttttcttcgctcctgcaggagcttttaaactgagtaattgctctttagattacattgct
tatccagaaaaaatagcgtcacataaggcacaccggaatataccttttatctcgaaagat
aattttgtaggtactccagacggttctagcatctacttaggaattaaaccagatgaagaa
accagttctattcaagaccttctttgttattttgatttgcttaatttttcgcaaaaaaat
gtattaacccaccaattaggactttctaaatggtcattaaacggtacacccctagaggtt
gttaatggctataacgagttagaatttgctggtcaagatttaaatacctatataaacgaa
tctatacagagtaagattaaattttacgaaaactatgtgaaggagttttaccaagagcac
ttctatacaatcacagataccatttcagtaaaagataatttaaaagattatcccgaagat
tttgaaaattttcttagtgagaaagatttaaaagaatttaatacgccattgctatggatc
aaaatttctttttcttctattgtttctagcaaaatgctagacaaccttcattgccatatt
aactgttttcctgtacttaataaaaagcgacatgaaaccaacagacgtttaaaatcttat
tttaatattttacctttagagatagacggggattacttctttgatgtgcaagatattata
ggagacagtggtaatacatattttattcaagacagaaagaaagaagatacatctacaagt
acacaagcttatttacgttttggcggtgtttctcgttttgatgagcgcgatgcttccgag
ctattaaattacacgatagatttacttaaagaagatagcattgcatttaatgcaatgaat
gatgattttatcaataccaacttaaaagatctaaaacagataatttctagaattgatcag
caaatagaattgagagattttaccaaaaataaaattccatatctagttatcaataagaat
agcattaacaaaaataaagatcaatttgtttttaccaattattggagcacagcaggagat
aaagctaataaaataaacccatatgtacaattggttcaatattcgggtactgcattttta
ccaaattcactaacttttattaccggtactatcggtggtaaagatgaacctagtgctagt
gaaaaaatttatgcctatagagagcacattctttctaaaggtaaaattattacaagacag
gatatcattcagcattgctttggtatttttaaagatagcattaaaaaagtaactatagaa
aaaggtgttgtcgttgcgcttgaagaaggcattggctatactcctactacagatgtttac
attacaaaacatgaagatgctgtttacgatgaagaaagctgggaacacctaaaaaaagaa
gtacttatcggactccaatcgcgatctgcaaatgtgcttccatttcgtattttttatagc
taa

DBGET integrated database retrieval system