KEGG   Caldilinea aerophila: CLDAP_10120Help
Entry
CLDAP_10120       CDS       T01797                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00620  Pyruvate metabolism
cap00640  Propanoate metabolism
cap00680  Methane metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_10120 (acsA)
   00620 Pyruvate metabolism
    CLDAP_10120 (acsA)
   00640 Propanoate metabolism
    CLDAP_10120 (acsA)
  Energy metabolism
   00680 Methane metabolism
    CLDAP_10120 (acsA)
Enzymes [BR:cap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CLDAP_10120 (acsA)
Lipid biosynthesis proteins [BR:cap01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CLDAP_10120 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAL99051
UniProt: I0I1B4
Position
complement(1261054..1262934)
Genome map
AA seq 626 aa AA seqDB search
MLEQILTRDERFEAPEWLKAQANLKDLEAEHARSLNDPEGFWGEWASRFVWLRPWSKVME
WEYPNHRWFVDGETNITLNALDRHADGPNRNKVALLWIGEDGSERKLTYYELRRMVSKLA
NGLRSLGVEKGDRVIIYMPLTVEGVLSMLACARLGAIHSVVYAGMGVGALRDRILDAGAK
VVIAGDVGMRRGKGVDLRSIVEQAIEDLSLRHVIWFQRGIKAELRPHEVDFDELLAQSKA
DVDPVPVDAEHPLYILYTSGSTGKPKGVVHVHGGYMVGTTYHLRNFYDVKDNDVFWATSD
IGWVVGHSYIVYAPLVEGVTSVFREGAPDWPHPGIFWECVEKYGVNVMFTAPTAVRMFMK
FGPEHVEKYDLSTLRLIAVAGEPLNPEAMRWAHKYLLDDGRRGFVADNWWQTELGAPAIA
TPIVKPAKPGAAGLPLPGVDAAVVDIEGNPVPKGKGGLLALKRPFPNMMRTVWGNHARYE
QYWNEIPNCYAAGDVASWDEEGYISVLGRSDDVLNVAGHRIGTADVESALITHPAVAESA
VIGVPDPIKGEAIKAFVVLRLGVEPGEEVRQSIIEHVRRELGPIATPSQVAFTEKLPKTR
SGKIVRRLLKAQELGQDPGDLSTLED
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgaacaaattttgactcgagatgaacgcttcgaggcgccggaatggctcaaggcg
caggccaatttaaaggatctggaggccgaacatgctcgcagtctgaacgatccagagggt
ttctggggagaatgggcctcccgcttcgtatggctccgcccctggagcaaggtgatggaa
tgggagtatccgaatcatcgctggttcgttgatggggagaccaatatcacgctcaatgcg
ctcgaccgtcacgccgatggaccgaatcgcaacaaggtggcgctgctgtggatcggcgaa
gatggcagcgaacgcaagctcacctactatgagctgcgacgcatggtctccaaactggcg
aacggcctgcgcagccttggcgtcgaaaagggcgaccgcgtcatcatttacatgcccttg
accgttgagggtgtcctctcgatgctggcctgtgcgcggttaggcgccattcactccgtc
gtctacgcaggcatgggggtaggcgcgctgcgtgatcgcatcctcgacgctggcgccaaa
gtcgtaatcgccggcgacgttgggatgcgccgcggcaaaggcgtagatttgcgcagcatc
gtcgaacaggctatcgaggacctgtcgctgcgtcatgtcatctggtttcagcgcggaatc
aaagcggaactgcggccgcatgaggttgatttcgatgagctgcttgcgcaaagcaaagcc
gacgtcgatccagttcctgtcgatgccgaacatccgctctacatcctctatacctctggc
tccaccggcaagccgaagggcgtcgtccacgtgcacggcggctacatggtgggaaccacc
tatcatctgcgcaatttctacgacgtcaaggacaacgatgtcttctgggcgacctcggac
atcggctgggtggtagggcactcctacatcgtttacgcgccgctggtggagggcgtgacc
tcggtcttccgtgaaggtgcgccagactggccgcatccgggtatcttctgggaatgcgtg
gagaaatacggcgtcaacgtgatgttcacggcgccgacagcagtgcgcatgttcatgaag
ttcggcccggaacatgtcgaaaagtacgacctgtctacgctgcgcctgatcgccgtcgcc
ggcgagccgctcaacccggaagcaatgcgttgggcacacaagtacctgctggatgacggc
agacgcggcttcgtggctgacaactggtggcagacggagctgggcgcaccggccatcgct
acaccgatcgtcaaacccgccaaaccgggcgctgccgggctgccgctgcccggggtggac
gctgcagtggtggacatcgaaggcaaccctgtgcccaagggcaaaggcggactgctggcg
ctcaaacgccccttcccgaacatgatgcgcaccgtttgggggaatcacgcccgttacgag
cagtactggaatgaaatccccaattgctatgcagcgggcgacgtggcgagctgggatgag
gaaggctacatctcggtgttggggcgcagcgacgacgtgctcaacgtggctggccatcgc
atcggcacggcggacgtggagtcggcgctgatcacgcatccggcggtggccgagtcggca
gtgatcggcgtgccggacccgatcaaaggcgaggcgatcaaggcatttgtcgtgttgcgc
cttggcgtggaaccaggggaagaggtgcgacagagcatcatcgaacacgtgcgccgcgag
ctggggccgatcgccacgcccagtcaggtagcattcaccgagaagctgcccaaaacgcgc
agcggcaaaattgtgcgccgattgctcaaggcgcaggagctaggccaggaccctggcgac
ctcagcacgctggaggattga

DBGET integrated database retrieval system