KEGG   Caldilinea aerophila: CLDAP_12850Help
Entry
CLDAP_12850       CDS       T01797                                 

Gene name
melA
Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
cap  Caldilinea aerophila
Pathway
cap00052  Galactose metabolism
cap00561  Glycerolipid metabolism
cap00600  Sphingolipid metabolism
cap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CLDAP_12850 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLDAP_12850 (melA)
   00600 Sphingolipid metabolism
    CLDAP_12850 (melA)
Enzymes [BR:cap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CLDAP_12850 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: BAL99324
UniProt: I0I237
Position
complement(1613100..1614422)
Genome map
AA seq 440 aa AA seqDB search
MPTITFIGAGSLVFTRNLCSDILLTPALQESTIVLMDIDPTRLEQARTIVQAMIDRRRLK
AKVVATTDRRAAVTDADYVITTFQQGGLDAYRLDIEIPQKYGVEQCVGDTLGPGGVFRAL
RTIPVLLDLCDELDELAPDALLLNYVNPMAANCWAIAEGTGRPHVGLCHSVQGTSEMLAS
WIGVPYEEVNFVCAGINHQAFFLEFRRGKEDLYPLIWKAIERPEIIAQEPVRTDLMKYFG
YFVTESSGHASEYVPYFRKNARMVNEELVPRFTDPVNHWFDFGRTGGYLRHCLHRLEQFQ
SEYEEIVSGEFPTTRSHEYGSYIIEAIETNRPVVIAGNVPNTGLITNLPEGCCVEVPCLV
NASGIQPTHIGALPPQLAALNRTNINVQSLIVEAALTGDVDAVYHAVMLDPLTAAVCTLP
QIHAMVTEMLKAQAQWLPQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccattacttttatcggcgctggcagtctggtctttacgcgtaacctgtgcagc
gacattttgttgaccccagcgctccaggaaagcacaatcgtgctgatggacatcgacccc
acccggctggagcaggcgcgcacgatcgtgcaggcaatgatcgatcggcgcaggctcaag
gcgaaggtcgtcgccacgaccgaccgtcgcgcggccgtgacggacgccgactacgtcatc
accacctttcagcagggagggctggacgcctatcggctcgatatcgagattccgcagaag
tacggcgtcgagcagtgcgtgggcgacaccctggggccaggcggtgtcttccgggcattg
cgcaccatcccggtgttgctcgacctctgcgatgaactggacgaactggctcccgatgcg
ctgctgcttaactacgtcaacccgatggccgccaactgttgggccatcgctgaggggacg
gggcgtccacatgtagggctttgtcacagcgtgcagggcacaagcgagatgctggcgagc
tggatcggcgtgccctacgaagaggtcaacttcgtctgtgcaggcatcaaccatcaggcc
tttttcctggagtttcgtcgcggcaaggaagatctctatccactgatctggaaggcgatt
gagcggccggagatcatcgcccaagagccggtccgcaccgacctgatgaaatacttcggc
tatttcgtcaccgagtcgagcggccacgccagcgagtatgtgccctatttccgcaagaac
gctcgtatggtaaacgaggagttggttcctcgttttacagatccggtcaatcactggttt
gactttggccgcacgggcggatatctgcgccattgtctgcatcggctggagcaatttcag
agtgaatatgaggaaattgtctccggcgagttcccaacgacgcgcagtcacgagtatggc
tcttacatcatcgaggccatcgagacaaacaggcctgttgtcatcgccggtaacgtgccg
aataccggtctgattaccaacctgccggaaggctgttgtgtcgaggtgccctgcctggtc
aacgccagcggcattcagccaacgcacatcggcgcgttgccgccgcagttggcggcgctc
aaccgcaccaacatcaacgtgcagagcctgatcgttgaagctgcgctcaccggcgatgtt
gatgcggtctatcatgccgtcatgctcgacccgctgaccgctgccgtctgcaccctgccg
cagattcacgccatggtgacggagatgcttaaggcacaggcgcagtggctgccgcaattt
tag

DBGET integrated database retrieval system