KEGG   Caldilinea aerophila: CLDAP_18010Help
Entry
CLDAP_18010       CDS       T01797                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cap  Caldilinea aerophila
Pathway
cap00020  Citrate cycle (TCA cycle)
cap00640  Propanoate metabolism
cap00660  C5-Branched dibasic acid metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
Module
cap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLDAP_18010 (sucC)
   00640 Propanoate metabolism
    CLDAP_18010 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CLDAP_18010 (sucC)
Enzymes [BR:cap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CLDAP_18010 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: BAL99840
UniProt: I0I3K3
Position
2262231..2263343
Genome map
AA seq 370 aa AA seqDB search
MFARYGIPVPSGEVATTPSEVRDIAVRLGGSVVVKSQVLVGGRGKAGGIKLARTPDEAEQ
RADEILGMKIKGLTVKKVLVDPIADIRKELYLGAVLDRASRRIVMMASSEGGVDIEEVAA
KTPEKIVKVGAHPFLGLRSHHARILADGIGLPKELTNDFIKIAQGLYQAFINTDASLAEI
NPLVITGDNKLMALDGKISVDDNALFRHPELAEMRDPDEEDPSEREAHRYGLSYIHLDGE
IGCMVNGAGLAMATMDIVKLYGGEPANFLDIGGGAQSDKVAAALRIILSDSRVKAVLINI
FGGITRCDEVARGVLEAIGTLDGRVPFVVRLVGTNEEEGRRILAEANLITATSLADAAQK
AVAAAKGELR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcccgctacggcattccggttccgagcggagaagtggcgaccacgccgagcgag
gtgcgcgatatcgccgttcgtcttggcgggtcagttgtggtgaaatcgcaggtattggtc
ggcgggcgtggcaaggcgggcggcatcaagctggctcgcacgccagatgaagccgagcag
cgtgccgacgaaattctgggcatgaaaattaaagggttgacggtgaagaaagtgctcgtc
gaccctatagccgacatccgaaaagaactctatctgggcgccgtgctcgaccgcgccagc
cgacgcatcgtgatgatggcgagcagcgagggcggtgtcgacatcgaagaggtagcagcc
aaaacgccggaaaagatcgtcaaggtgggtgcacatcccttcctcggtttgcgctctcac
catgcccgcatccttgccgacggcatcgggcttcccaaagagctcaccaatgatttcatt
aaaattgcacaaggtctttatcaggctttcatcaacaccgacgccagcctggccgagatc
aacccgctggtcatcacaggcgacaacaagctgatggcgctcgacggcaaaatttcggtc
gacgacaacgcgctcttccggcatcctgagctggccgagatgcgcgacccggacgaggag
gaccccagcgaacgcgaggcgcatcgctatggcctgagttacattcacctcgatggcgag
atcggctgtatggtcaacggcgccggcctggccatggctacgatggacatcgtcaagctg
tatgggggtgagccggccaacttcctcgatatcggcggcggcgctcaatcggacaaagtg
gcggcggcgctgcgcatcattctcagtgacagtcgcgtcaaggcggtgctgatcaacatt
ttcggcggcatcacgcgctgcgatgaagttgcgcgcggggtgctggaggcgatcggaacg
cttgatggccgcgtgcccttcgtcgtccgtctggtcggcaccaacgaggaggaaggtcgg
cgaattctggccgaagccaatttgatcaccgccaccagcctggccgacgctgcgcagaag
gcggtggctgccgccaaaggagaactacgatga

DBGET integrated database retrieval system