KEGG   Caldilinea aerophila: CLDAP_19110Help
Entry
CLDAP_19110       CDS       T01797                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cap  Caldilinea aerophila
Pathway
cap00860  Porphyrin and chlorophyll metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
Module
cap_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLDAP_19110 (hemD)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLDAP_19110 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAL99950
UniProt: I0I3W3
Position
2389987..2390841
Genome map
AA seq 284 aa AA seqDB search
MTPTTPSFVHSSALQGRRIVITQATHQAPAFATLLEHWGAVPLLYPCIAIQSPGDPTPLD
SSLRLAAQGGFDWLVLTSANAVRIVAQRLAALAIAPQRLSALRIAVVGAATARCVQEELG
LEVAVAPQEEVAEGLADALEAVVRPGERILLPQSALARDVLRKRLTAIGASVHPVVAYET
VRGEGGVDLPHLLAQRQVDAVTLASASAFRFLLERLTNEGGEPARLHSVCLACIGPITAR
AVQEAGFIPAVISMQQSLEGLATALADYFARADWHSSQQTQVIP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaccactccttcctttgtccattcgtcggctttgcagggacgacggatcgta
attacccaggcaactcatcaggcgcctgcgtttgcaacgctgctcgagcattggggtgcc
gttcccctgctctatccttgcatcgccattcagtcgccaggggacccgacaccgctcgat
tcaagcctgcgtctcgctgcgcagggcggtttcgactggcttgtgctgactagcgccaac
gccgtgcgcattgtggcacagcgtctcgccgcactggcgatcgccccccaacgactgagc
gccttgcgcatcgccgttgtaggcgcagcgaccgcccgctgtgtgcaggaggagcttggc
ctggaagtcgccgttgctccccaggaggaggttgccgaaggattggccgatgcgctcgaa
gcggtagtgcgccccggcgaacgcatcctgctgccccagtcggcgttagcgcgcgatgtg
ctccgcaagcgtcttacggcgatcggtgcatccgttcaccccgtcgtcgcctatgaaacc
gtgcgcggtgaaggcggcgtcgatctcccgcatctgctggcgcaacgccaggttgatgca
gtcacgctcgccagcgcgtctgcctttcgcttcttgctggagcgactgacgaatgagggg
ggcgagcccgcacggttgcacagcgtttgcctggcatgcatcgggccgatcacggcgcgc
gctgtacaggaagccggcttcatccctgccgtcatctccatgcagcagagcctggaagga
ctggctacggcgttggccgactatttcgcccgtgcagactggcacagttcacaacaaact
caggtgatcccatga

DBGET integrated database retrieval system