KEGG   Caldilinea aerophila: CLDAP_20280Help
Entry
CLDAP_20280       CDS       T01797                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00520  Amino sugar and nucleotide sugar metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
Module
cap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cap_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_20280 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_20280 (ppgK)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CLDAP_20280 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAM00068
UniProt: I0I480
Position
2547498..2548253
Genome map
AA seq 251 aa AA seqDB search
MQILGIDIGGSGIKGRLVDVERGELLGERHRIATPKPSTPAAVADVVAEIVRHFNYSGPV
GITFPAIVQHGVTLSAANVDPSWIGAPAQQIFAEATGLPVYVLNDADAAGVAEMTFGAGR
EFQQGVVILLTFGTGIGSAIFLDGKLLPNTEFGHVPMPMKGIDAEHYCSDKIRKGLDLKW
PAWAKRVDAYLKLMELLFSPDVFIIGGGVSKKFDKFAPYLQRRARIVPAQLLNEAGIVGA
AMMASRELVVQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcagatacttgggattgatattggcggcagcggcatcaagggacgcctggtagacgtg
gaacgcggtgaactgctcggcgaacggcaccgcatcgcaacgcccaaaccatcgacgccg
gcggctgtggcagacgttgtggccgaaattgtgcgtcatttcaactacagcgggccggtc
ggcatcacctttcccgccatcgtgcagcacggcgtgacgctttccgccgccaatgtggat
ccatcctggatcggcgcaccagcccaacagatctttgcagaggccacaggattgcccgta
tacgtcctcaacgatgcagatgctgccggcgtcgccgagatgaccttcggcgcaggccgc
gaatttcaacaaggggttgtcattttgctgaccttcggcaccggcatcggcagcgccatt
tttctcgatggaaagttgttgcccaacaccgaatttgggcatgtgccgatgccaatgaag
ggcatcgacgccgaacattattgttccgataaaattcgcaaagggttagacttgaaatgg
cctgcgtgggcgaagcgcgtcgatgcctacttgaagttgatggagctgcttttttcgccg
gatgtgttcatcatcggtggaggcgtcagcaagaagttcgacaaatttgccccctatctt
cagcgcagagcccgcatcgtgccggcacagttgctgaacgaagcagggattgttggcgca
gcgatgatggcaagccgggaactggtcgtccagtag

DBGET integrated database retrieval system