KEGG   Caldilinea aerophila: CLDAP_20960Help
Entry
CLDAP_20960       CDS       T01797                                 

Definition
(GenBank) putative phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
cap  Caldilinea aerophila
Pathway
cap00627  Aminobenzoate degradation
cap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cap00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CLDAP_20960
Enzymes [BR:cap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     CLDAP_20960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase TraT
Motif
Other DBs
NCBI-ProteinID: BAM00136
UniProt: I0I4E8
Position
2622629..2623489
Genome map
AA seq 286 aa AA seqDB search
MMIDPISLLSAIRAVLFDMDGVIYVGHRPLPGVQELLDYLDATGRRWMLVTNNAALTSQQ
FSEKVAAMGLRVPPERILGSAEATASWLRHQVEKGWPEGKVIVNGQDGLRTALTAAGFEL
TSDPFEATYAVSGANFKLTYEDLANVTLAIRNGARFIGTNSDRTYPTERGQVPGAGAVLA
LFTAATDQEPIVIGKPNAPMFEEAMRRLGVTAEETMMVGDRYETDIVGALKLGMLTVGVL
TGVDTRATFEAQSVPPHLIVEGLPELLAHFQLADQQQTIQAVRSSQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgaccccatttccctgctttccgctatccgcgccgtcctgtttgacatggac
ggcgtgatctacgtcggccatcgaccgttgcccggtgtgcaggagctgcttgactatctc
gacgccaccggtcggcgctggatgctggtcaccaacaatgccgcgctgacctcgcagcaa
ttcagcgaaaaagtggcagcaatggggctgcgcgtgcctccggagcgcatcctcggcagc
gccgaggcaacggcaagctggctgcgccatcaggttgagaaagggtggccagagggcaag
gtgatcgtcaacggacaggacggcttgcgcaccgcgctgactgcggccggcttcgagctg
acaagcgatccctttgaggccacctacgccgtgtcgggcgccaacttcaagctcacctat
gaggatctggccaatgtaaccctggcgatccgcaacggcgcacgcttcatcggcaccaac
agcgaccgcacctatcctaccgagcgcggacaggtgccaggcgctggcgctgttctggcg
ctcttcacggcagccacggatcaggagccgatcgtgattggcaagcccaacgccccgatg
ttcgaggaggcgatgcgccgactcggcgtgacggcggaggagaccatgatggtgggcgac
cggtatgagacggatatcgtcggcgcgctgaagctggggatgctgacggtcggtgtgctc
accggcgttgacacgcgggcaacgttcgaggcgcagagcgtgccgccacacctgatcgtc
gaagggttgccggaactgctggcgcatttccaacttgcagaccaacaacagaccattcaa
gcggtgcgttcatcacaatga

DBGET integrated database retrieval system