KEGG   Caldilinea aerophila: CLDAP_37580Help
Entry
CLDAP_37580       CDS       T01797                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cap  Caldilinea aerophila
Pathway
cap00860  Porphyrin and chlorophyll metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
Module
cap_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLDAP_37580 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cap01007]
    CLDAP_37580 (hemL)
Enzymes [BR:cap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CLDAP_37580 (hemL)
Amino acid related enzymes [BR:cap01007]
 Aminotransferase (transaminase)
  Class III
   CLDAP_37580 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAM01798
UniProt: I0I960
Position
complement(4702395..4703735)
Genome map
AA seq 446 aa AA seqDB search
MNPVKTRTHQLFAKAKQYIPYGVNSNFRYWGDENTPILTRGAGAYVWDADDNRYIDYRLG
FGPIILGHAYPEVTRRVAEAIQNGVLFAATTPIEIELAERFTRMTGMDKVRLSNTGTEAN
MHALRIARAYTGREKFIKFEGNYHGNFDYVMFSGPTAKAELLGPRNHPHRLRATEGMPVA
IRNYMISLPYNDIELLERAMVEHSDELAAVIVEPIMGNVACILPDPAWLRRVRELCDEFD
IVLIFDEVKTGFRLAPGGAQQYFGVKADLAAYAKAMGNGFPVSAVAGREEIMAVVEPGRV
AHGGTYCGNVVAATAAAATLEIIETQPVIETIFANGRRLIDGIHTILRQVGAPHVISGVP
SMFSVLLGKDEPPTDYRSYAEFDSELFGLFGAELIRRGVLIDDDPREPWFLSFSHDAAVI
DESLNLIEDAAKAVFRTAARTRRLAA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgttaaaacaagaacgcatcaactcttcgccaaagcaaagcagtacattccc
tacggcgtcaattcgaatttccgctactggggagacgagaacactccgatcctgacgcgc
ggggcaggcgcgtatgtatgggacgccgatgacaaccgctatatcgactaccgcctcggt
tttgggccgattattctgggccacgcctatcctgaagtcacccgtcgcgtcgcagaagct
atccagaacggcgtgcttttcgccgccaccacgccgatcgaaatcgagcttgccgaacgg
ttcacgcgcatgaccggcatggataaggtgcgcctttccaacacgggcaccgaagccaat
atgcatgccctgcgcattgcgcgcgcctacaccggccgtgaaaagttcatcaagttcgaa
ggcaactaccacggcaacttcgactacgtcatgttcagcggtccgacggcgaaggcggag
ctgctgggcccacgcaaccatccgcatcgcctgcgcgccaccgagggcatgccggtcgcc
attcgtaactacatgatttcgctgccctacaacgacattgaactgctggagcgcgccatg
gtcgagcacagcgacgaactggcggcagtaatcgtggagccgatcatgggcaacgttgcc
tgcatcctgcccgacccagcctggctgcgccgcgtgcgcgagctgtgcgatgagtttgat
atcgtgctgattttcgatgaggtgaaaaccggtttccgcctcgctccgggcggcgctcag
cagtacttcggcgtcaaggccgacctggccgcctacgccaaggccatgggcaatggtttc
ccggtctcggcggtagcagggcgagaggagatcatggcggtcgtggaaccgggtcgcgtg
gcacatggcggcacctactgcggcaacgtcgtcgctgcgacagcggcggctgcaacgctg
gaaattattgagacgcagcctgtcattgagaccatcttcgccaatggacggcggctgata
gatggaatccacaccatcttgcgtcaggtcggcgcgccgcatgtgatcagcggcgtcccg
tcgatgttcagcgtgttgctgggcaaggacgaaccgccgaccgactatcgcagctatgca
gagtttgacagtgagctgtttggcctgtttggcgccgagttgattcgccgcggcgtgctg
atcgacgatgacccacgtgagccctggttcctctctttcagtcatgacgctgcggtcatc
gatgagtctctgaacctcattgaagacgctgcaaaggctgttttccgcacggctgctcga
actcgccgcctggctgcctga

DBGET integrated database retrieval system