KEGG   Capnocytophaga sp. ChDC OS43: CBG49_06455Help
Entry
CBG49_06455       CDS       T04940                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
capn  Capnocytophaga sp. ChDC OS43
Pathway
capn00020  Citrate cycle (TCA cycle)
capn01100  Metabolic pathways
capn01110  Biosynthesis of secondary metabolites
capn01120  Microbial metabolism in diverse environments
capn01130  Biosynthesis of antibiotics
capn01200  Carbon metabolism
Module
capn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
capn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:capn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBG49_06455
  09105 Amino acid metabolism
   00310 Lysine degradation
    CBG49_06455
   00380 Tryptophan metabolism
    CBG49_06455
Enzymes [BR:capn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CBG49_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N PRCC
Motif
Other DBs
NCBI-ProteinID: ASF42743
UniProt: A0A1Z4BNC6
Position
1413691..1414965
Genome map
AA seq 424 aa AA seqDB search
MLEMKVPSPGESITEVEIARWLVKTGDYVTKDQAVAEVDSDKATLELPAEASGIITLQAE
EGEAVKVGQVVCLIDTTAVPTAPTAPAVPTAPTAPTVPTAPTVSTAPTTPACPPSGERGQ
SESPTAPASPTSGDRGLSPAARKILAEREIPASTVVGTGKGGRITKNDALKASKPSMGTP
TGGVRRETRAKMSMLRRKVAERLVSAKNETAMLTTFNEVDMTAIYQLRAEYKDAFKERHN
VSLGFMSFFTLAVVRALKLFPDVNSMIDGQDKVTYDFCDISIAVSGPKGLMVPVIRNAEN
LSFRGVEAEVKRLATRARDGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMH
NIVDRPIVRNGQIVIAPVMYVALSYDHRIIDGRESVGFLVAVKEALENPIELLMNGNPKQ
ALEL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaatgaaagtcccctcacctggggaatctatcaccgaagtagaaatagcccgt
tggcttgtaaaaaccggggattacgtaactaaagaccaagctgttgccgaagtagattcc
gataaggcaacccttgaacttcccgctgaagctagcggaattattacattgcaagccgaa
gaaggcgaagccgtaaaagtaggacaagtagtatgcttaatcgatacaaccgctgttccc
acagcccccacggctcccgctgttcccacagcccccacggctcccactgttcccacagcc
cccactgtttccaccgctcccaccacaccagcttgtcccccttcgggggaacgggggcaa
tcagaatctcccaccgcaccagcttctcccacttcaggagatcgaggactatcaccggcc
gctcgcaagatattagcagaacgcgagattcctgcatcaacagtagtaggtactggcaaa
ggaggtcgtatcaccaaaaacgacgctcttaaagcctctaagccatcaatgggaaccccc
acaggtggtgtgcgtcgtgaaacacgtgctaagatgagtatgttgcgccgtaaagtagcc
gaacgtttagtgagtgctaaaaacgaaaccgctatgctcactactttcaatgaggttgat
atgacggctatctatcagttgcgcgccgaatataaggacgctttcaaagaacgtcacaac
gtgagtctcggttttatgtcgttcttcactttggcagtagtacgcgccctcaaactcttc
cccgatgtcaattcaatgattgatggtcaagacaaagttacttacgatttctgcgacatc
tctatcgccgtatcaggccccaaaggattgatggtgcccgtcattcgcaacgccgaaaac
ctctccttccgcggtgttgaagccgaggtaaaacgcttagcaacccgtgctcgtgatgga
caaattacggtagatgagatgaccggaggtactttcaccattaccaatggaggtgtcttc
ggatcaatgttgtctactcctattataaatccaccgcaatcaggcattttgggtatgcac
aatatcgtcgatcgccctatagtgcgcaatggtcaaatagtaattgcccccgtgatgtat
gtcgccctttcttacgaccaccgtatcatcgacggacgtgaatcagtaggatttttagta
gcagtaaaagaagctcttgaaaatcccatcgagctcctaatgaacggcaacccaaaacaa
gcccttgaactctaa

DBGET integrated database retrieval system