KEGG   Capnocytophaga sp. ChDC OS43: CBG49_11045Help
Entry
CBG49_11045       CDS       T04940                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
capn  Capnocytophaga sp. ChDC OS43
Pathway
capn00564  Glycerophospholipid metabolism
capn01100  Metabolic pathways
capn01110  Biosynthesis of secondary metabolites
Module
capn_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:capn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBG49_11045
Enzymes [BR:capn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CBG49_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF2232
Motif
Other DBs
NCBI-ProteinID: ASF43567
UniProt: A0A1Z4BQI7
Position
complement(2443434..2444084)
Genome map
AA seq 216 aa AA seqDB search
MFHKEGFKIILVTLFIVIGVSLIAHYFVDILWLKKGIQLLAIVFLIAILQFFRNPKRITP
RNDQHIIAPVDGKVVVIEEVFEKEYFKDKRLQVSIFMSPINVHVTRYALGGKVTYSEYHP
GKYLVAWHPKASEENERTTVVVDNPIFGEVLYRQIAGALAKRIVNYAKVGDTAVQGEDAG
FIKFGSRVDVYLPLGTKVKVKLGDKVKGGVQVIAEK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaagaaggttttaagattattctcgtaacgctatttatagtgataggagta
tcactaatagcacattattttgttgatatactatggcttaagaaaggtatacaactctta
gctattgtatttctcatagctattttgcagtttttcagaaatcctaaacgcataacacct
cgaaatgaccaacacatcatagcccctgtagatggcaaggtggtggtgatagaagaagtg
tttgaaaaagagtatttcaaagataaacgcttgcaggtatccatctttatgtcgcctatc
aatgtacacgtaacacgttatgcattagggggtaaagttacttatagtgagtatcaccca
gggaagtacttggtagcgtggcatccaaaggcttcagaagaaaatgaacgtactaccgta
gtggtagataatcctatatttggagaagtgttataccgacaaatagcaggagccttggca
aaacgcattgtaaattacgctaaagtaggcgacactgctgtacaaggagaagacgctgga
tttattaaatttgggtcacgtgtagatgtgtatttgcctttgggaactaaagtaaaagta
aagttgggcgacaaggtaaaaggaggcgtgcaagtaattgctgaaaaatag

DBGET integrated database retrieval system