KEGG   Capnocytophaga sp. H2931: CGC52_00020Help
Entry
CGC52_00020       CDS       T05889                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
capq  Capnocytophaga sp. H2931
Pathway
capq00564  Glycerophospholipid metabolism
capq01100  Metabolic pathways
capq01110  Biosynthesis of secondary metabolites
Module
capq_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:capq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGC52_00020
Enzymes [BR:capq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CGC52_00020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-ProteinID: ATA73966
UniProt: A0A250EQL3
Position
2805..3458
Genome map
AA seq 217 aa AA seqDB search
MFHREGFKIILGTFIVTAGIALLAHYFVDIFWLQKLIQGIALIFLILVLQFFRNPKRNTQ
RNENHIIAPVDGKVVVIEKVFEKEYFKDERLQVSIFMSPINVHVTRYAIGGEVVFSKYHP
GKYLVAWHPKASEENERTTVVVENHTFGKILYRQIAGALAKRIVNYAKEGDIAIQGADAG
FIKFGSRVDLYLPLDTQINVQLGQTVKGGIDIVAKKD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacagagaaggttttaaaattattttaggaacatttatagtaactgcaggaatc
gctttactggcacattatttcgtagatattttttggttacagaaactcattcaaggtatt
gcacttatttttttgattttggtattacaattttttagaaatccaaagcgaaatacgcaa
agaaatgaaaatcacatcatcgctcccgttgatggaaaagtggtagttattgaaaaagta
ttcgaaaaagaatatttcaaagatgaacgtttacaagtatcaatttttatgtcgccaata
aatgtgcatgtaactcgctatgctataggcggagaggttgtgtttagcaaataccatcct
ggaaaatatttagttgcttggcatccgaaggcatctgaagaaaacgaaagaacaaccgtt
gttgttgaaaatcatacttttgggaaaatattatatcgtcaaattgcaggagctttggcg
aagcgtattgtaaactatgctaaagagggcgatatagctattcaaggagctgatgctgga
tttattaaattcggttcacgtgtggatttatatctgccgttagatactcaaatcaatgtc
caattgggacaaacagttaaaggcggtattgatattgtggcgaaaaaagattaa

DBGET integrated database retrieval system