KEGG   Capnocytophaga sp. H2931: CGC52_02155Help
Entry
CGC52_02155       CDS       T05889                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
capq  Capnocytophaga sp. H2931
Pathway
capq00900  Terpenoid backbone biosynthesis
capq01110  Biosynthesis of secondary metabolites
capq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:capq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGC52_02155
Enzymes [BR:capq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     CGC52_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red DUF2322
Motif
Other DBs
NCBI-ProteinID: ATA74346
UniProt: A0A250ERL5
Position
515186..516484
Genome map
AA seq 432 aa AA seqDB search
MKNISGFSKLTKQQKIQWLCDTYFPDDKDAFSNFKKYHNADETLQKLHDEFIENTVTNFY
LPFAVAPNFVINGKTYTVPMAIEESSIVAAASRAAKYWETRGGFKAEVISTEKNGQVHLM
FYGKKADLECFFEKIHSKMLTDAKHITSNMEKRGGGISTLRLVDKTSELANYYQLFASFE
TLDAMGANFINSCLEQFAETFRQEALKHPEIDGKYEIVMSILSNYVPECLVKVSTSSPVE
NLAVAGLSGKEFAEKFVRAIAIANSEVRRATTHNKGIMNGMDAVILATGNDFRAVEAGVH
AYAARSGKYQSLTKAHIKDEIFHFEIEVPLALGTVGGLTNLHPLVKTALQILEKPSASEL
MQIVATVGLAQNFAAVSSLITLGIQKGHMKMHLMNILNQLGASDRQKEQITEYFKDKTVT
HSEVVRIFEQTK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatttcaggattttccaaactgactaaacagcaaaaaatacaatggctttgc
gacacttatttccctgatgataaggatgctttctctaattttaaaaaataccacaacgcc
gatgaaactctccaaaaattacacgatgaatttattgagaatacggtaacgaatttctac
ctaccgtttgccgtagccccaaattttgttatcaatggaaaaacttacaccgttccaatg
gcaattgaagaaagctctattgtagcggctgcaagtagagctgcaaaatactgggaaaca
cgtggaggatttaaagccgaagtcatttccacagaaaaaaatggacaagtacatctcatg
ttttatggtaaaaaagctgatttagagtgtttttttgagaaaatacactcaaaaatgctt
actgatgcaaaacacattacctctaatatggaaaaaagaggaggaggcatttcaacactt
cgcttggtggataaaacctcagaattagccaattactaccaattgtttgcttcctttgaa
acgctggatgctatgggtgcaaatttcatcaattcgtgcttagaacaatttgcagaaaca
tttcgtcaagaagctttaaaacatcctgaaattgatgggaaatacgaaatcgtaatgtca
attttatcgaattatgtacccgaatgtttggtaaaagtaagtacatcctcgcctgtggaa
aatttggctgttgcaggattgagcggtaaggaatttgctgagaaatttgtacgagccatc
gcgatagctaattccgaagtacgacgagcaactacgcataacaagggtatcatgaacgga
atggatgctgtcattttagccacagggaatgatttcagggctgtggaggcaggagttcat
gcctatgccgctcgttcaggaaaataccaaagtttgacaaaagcgcatatcaaagatgaa
atttttcatttcgaaatcgaagtaccgttggctttgggcacagtaggtggactaacaaac
ttacatcctttggtaaaaacagccttacaaattttagaaaaaccctctgcctctgaacta
atgcaaattgtagccaccgttggcttggctcaaaattttgctgctgtaagttctttgatt
actttgggaattcagaaaggacatatgaagatgcatctaatgaacattttaaaccaattg
ggagcaagtgacagacaaaaagaacaaatcaccgaatacttcaaagataaaacggttaca
cacagcgaagtagttcgtatttttgaacaaacaaaatga

DBGET integrated database retrieval system