KEGG   Capnocytophaga sp. H2931: CGC52_02340Help
Entry
CGC52_02340       CDS       T05889                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
capq  Capnocytophaga sp. H2931
Pathway
capq00860  Porphyrin and chlorophyll metabolism
capq01100  Metabolic pathways
capq01110  Biosynthesis of secondary metabolites
Module
capq_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:capq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CGC52_02340 (hemN)
Enzymes [BR:capq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CGC52_02340 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C HTH_45 DUF2517
Motif
Other DBs
NCBI-ProteinID: ATA74380
UniProt: A0A250EN92
Position
554217..555581
Genome map
AA seq 454 aa AA seqDB search
MTVSLIQKYNVAGPRYTSYPTVPYWDNESFSNDKWLNSLKRSFHESNKTEGISLYIHLPF
CESLCTFCGCHKRITKRHEMESPYIDAVLKEWKLYLDVLQEKPLIKEIHLGGGTPTFFKP
EELKRLLEGIFEYADIAKDKEFSFEGHPNNTTETHLRVLYSLGFERVSFGVQDYSLKVQK
AIHRIQPFENVKKVTEWARKIGYKSVSHDLVFGLPFQTLDDVLFTIDKTNSLHPDRIAFY
SYAHVPWIKGSGQRGFDESNLPSGEEKRLLYETGKKHLIDAGYVEIGMDHFALPTDSMYK
SFETNSLHRNFMGYTASKTQVMIGLGMSSISDSWYGFAQNEKDLEDYYARIQRNEIPVFR
GHILNEEDLIIRQHILNLMCHFNTSWEEDKMYTSEIESIKSKLNEMVSDGLIELREKSIR
VTNEGRPFVRNLCMAFDLRLQRNIPNTKIFSMTV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcacttatacaaaaatacaacgttgcggggccgcgttacacgagttatcca
acggttccatattgggataatgaatctttttcgaatgataaatggctaaatagtctaaaa
agatcatttcacgaaagcaacaaaacagagggaatcagcctttatatccatttgccattt
tgcgaaagtttatgcactttctgcggatgtcacaaacgcatcaccaaacgacacgaaatg
gagagtccttatattgatgctgttttgaaagaatggaaattatatttagatgtgttgcaa
gaaaaacctctcattaaagagattcatttgggaggaggcacaccaacgttctttaaacca
gaagagttaaaacgtttgcttgagggcatttttgaatatgctgacattgctaaggataaa
gaatttagctttgaaggacatcctaacaacactacagagactcatttaagagttttgtac
agtttaggattcgaacgagtaagttttggagttcaagactattctttaaaagttcaaaag
gcaattcatcgcatacaaccgttcgaaaacgtaaaaaaagttacagaatgggcaagaaaa
ataggatataagtccgtgagccatgatttagtattcggattgcctttccagactcttgac
gacgtactgtttactattgataaaacgaatagtttgcaccctgataggattgcgttttat
agctatgcccatgttccttggattaaaggtagtggacagcggggatttgatgagagcaac
ctgccttcgggggaggagaagcggttactctacgaaactggcaagaaacatttgatagat
gcaggatatgttgaaataggtatggatcattttgctttaccaactgattcaatgtacaaa
tcatttgaaaccaacagcttacaccgaaattttatggggtacacagcctcaaaaacccag
gtaatgattggtttaggaatgtcctctatcagtgatagctggtacggatttgctcaaaat
gagaaagatttggaggattattacgcacggatccagcggaatgagatccctgtttttaga
ggacatatcttaaatgaagaagatctaattatccgtcagcatatcctaaatttgatgtgt
catttcaatacttcatgggaagaagacaaaatgtacacctctgaaatagagtctattaag
tcaaaattaaatgaaatggtcagtgacggtcttattgagctgagggagaaaagcatacga
gtaaccaatgagggaagaccttttgtgaggaatttgtgtatggcgtttgatctacgttta
cagcggaatataccgaatacaaaaatttttagtatgactgtataa

DBGET integrated database retrieval system