KEGG   Capnocytophaga sp. H2931: CGC52_06335Help
Entry
CGC52_06335       CDS       T05889                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
capq  Capnocytophaga sp. H2931
Pathway
capq00633  Nitrotoluene degradation
capq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:capq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CGC52_06335
Enzymes [BR:capq01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     CGC52_06335
  1.-  
   1.-.-  
    1.-.-.-  
     CGC52_06335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase DUF4755 SAP30_Sin3_bdg
Motif
Other DBs
NCBI-ProteinID: ATA75069
UniProt: A0A250EQ52
Position
1502053..1502649
Genome map
AA seq 198 aa AA seqDB search
MRFIELAQNRYTTKAYNNKKIDQNLICELKEILRLSPSSINSQPWRFIIVSDEKTKRALA
DVSHFNKSKINETSHLVVFLGFKDLRKFEKQITDFLPEGAVNYYHQVLKPKGDEQVHIWL
NKQVYISLGFFLSACASMNIDSTAMEGIQNEKYDEILQEEGYQTLFAVAIGYRHEDDANQ
PDRNPKLRLPLEQVVKEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagatttatagaattagcacaaaaccgatatacaacaaaagcatataataacaagaaa
attgaccaaaatctcatttgcgaactgaaagagattttgcgtttaagtccttcatcaatc
aattcacagccttggcgctttatcattgtttcagacgaaaagacaaaacgggccttagct
gatgtttctcattttaacaagagtaaaatcaacgaaactagtcatttagtagttttttta
ggttttaaagaccttcgtaaatttgaaaaacaaatcactgattttctcccagaaggtgcg
gtgaactactatcaccaagtactaaaacccaaaggcgatgaacaagttcatatatggcta
aacaaacaagtatacatttcattaggattctttttaagtgcttgtgcatcaatgaacatt
gattctacagctatggagggcatccaaaatgagaaatacgatgaaatcttacaagaagaa
ggttatcaaactttatttgcggtcgctatcggttatcgccatgaagatgacgcaaaccag
ccagaccgaaatccaaaattacggttacccttagaacaggttgtaaaagagatatag

DBGET integrated database retrieval system