KEGG   Caproiciproducens sp. NJN-50: EQM14_02075Help
Entry
EQM14_02075       CDS       T05807                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase family protein
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
capr  Caproiciproducens sp. NJN-50
Pathway
capr00561  Glycerolipid metabolism
capr00640  Propanoate metabolism
capr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:capr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EQM14_02075
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    EQM14_02075
Enzymes [BR:capr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     EQM14_02075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: QAT48665
UniProt: A0A410Q024
Position
complement(406166..407281)
Genome map
AA seq 371 aa AA seqDB search
MANQNIYLPHYSVGEDCYREIPFITRNFGKKAVVIGGKTAMAKAKEAIRAGVAGSDVSLL
GFLWYGGDSSFENVENLKKDPLVQQAEMLFGVGGGRACDTVKTLGDMLDKPVFTFPTLAS
NCASCTNLSVIYNKDGSFKEYYYQKQPACHTFINTRIIAESPYDMFWAGIGDALSKEYEV
VFACRDKKLHHLPLLGLGIAKTCTSPLLSLGTQALEDCKNNKVSFALEQVALDIIMLTGI
VSNCTVHQNQPDPKDDYYYNSSLAHCVYYGSSLVPACEKHLHGEIVSFGVLCLLTYDRQF
EERDRILAFNKSVGLPVTMAEIGLTQADLPVVAKKASSVVEWTYAPGNPTEERFMQAVRD
ADTAGRQALGK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccagaacatctatttaccccattacagcgttggagaagactgttatcgtgaa
attcctttcatcacaagaaacttcggcaaaaaagcggttgtcatcggcggaaagacggca
atggcaaaggcaaaggaagcgatccgggcgggcgtggccggttcggacgtcagcctcctc
ggttttttgtggtacggcggagactccagttttgaaaacgttgaaaatctgaagaaggac
ccgctcgttcagcaggcggagatgctgttcggggtcggcggcggcagggcctgcgacacg
gtcaaaaccctgggtgacatgctggacaaaccggttttcacctttccgacgcttgcttcc
aactgcgcgagctgcacaaacctgagcgtgatttataacaaggacggctccttcaaagag
tattattatcagaaacagcccgcctgccacacgttcatcaacacgaggatcatcgccgaa
tcaccgtatgacatgttctgggccgggatcggtgacgcgctttccaaggaatacgaagtc
gtgtttgcctgccgcgacaagaagcttcatcatcttccgcttctggggctcggaattgca
aaaacgtgcacctcgccgcttctcagcctcggaacgcaggctcttgaagactgcaaaaac
aacaaggtctcgtttgcgcttgagcaggttgcgctggatatcatcatgctcaccggcatc
gtatcgaactgtaccgtacaccagaatcagcccgatcccaaagacgattattattacaac
agttcgctcgcccattgcgtctattacggcagttcgctggttccggcgtgcgaaaaacac
ctgcacggcgagatcgtttcgttcggcgtgctgtgccttctcacttacgaccgccagttc
gaggagcgggaccggattctcgcgtttaacaaaagcgtcgggctgccggttacaatggct
gaaatcggcctgacccaggccgaccttccggtcgtcgcaaaaaaagcgtcctcggttgtc
gagtggacctatgcccccggaaacccgaccgaagaaagattcatgcaggccgtcagggac
gccgacacggccggcagacaagccctgggaaaatag

DBGET integrated database retrieval system