KEGG   Caproiciproducens sp. NJN-50: EQM14_12570Help
Entry
EQM14_12570       CDS       T05807                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
capr  Caproiciproducens sp. NJN-50
Pathway
capr00670  One carbon pool by folate
capr01100  Metabolic pathways
capr01120  Microbial metabolism in diverse environments
capr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:capr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EQM14_12570 (metF)
Enzymes [BR:capr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     EQM14_12570 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: QAT50530
UniProt: A0A410Q5J1
Position
complement(2594404..2595279)
Genome map
AA seq 291 aa AA seqDB search
MRTNELFKRKTVFSFEVFPPKKTSSIDVVYHTLQELNGLSPDFISVTYGAAGGGSNHTVQ
IASAIKNRYGLESVAHLPCINFTKEEVLETLESLKRNGIENILALRGDLSPDIPPKADFR
HASDLISFLKENGDFNIIGACYPEGHPESGGIVKDILNLKKKVDAGADQLISQLFFDNSC
FYSFLERARIAGIDVPIQAGIMPVTNRKQIERMVTLCGATLPKKFVKVMERYGDNPNAMR
DAGIAYAIDQIVDLVAQGVDGIHLYTMNNSYVATKISEAVTSLLKANKITA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaacgaactgttcaaaagaaaaacggtgttttcttttgaagtctttccgccc
aagaaaacttcttcgatcgatgtagtttatcatactctgcaggagctgaacgggctttcc
cccgatttcatcagcgttacttacggagccgcgggcgggggaagcaaccacaccgttcag
attgcctccgctatcaagaacagatacggccttgagagcgtcgcccatctcccatgcatc
aactttacgaaggaggaagtgcttgagacgcttgaaagcctgaagcggaacggcattgaa
aatattcttgcgctgcgcggggacctcagcccggatattccccccaaggccgatttcagg
cacgcgagcgacctgatttcgttcctgaaggaaaacggcgatttcaatatcatcggggcg
tgttacccggagggacatccggaatcgggcggaattgtaaaggacattcttaatttgaag
aaaaaagttgacgcgggcgcggaccagttgatttcccagctttttttcgacaacagctgt
ttctattccttcctggaacgcgccagaattgccggaatcgatgtgccgatccaggccggg
atcatgccggtgacgaacagaaagcagattgaacggatggttaccctctgcggggcgacg
cttcccaaaaagtttgtcaaagtgatggaaaggtacggggataatccaaacgcaatgcgg
gatgcggggatcgcctacgcgatcgaccagattgtcgatcttgtcgcgcagggagtggac
ggaatccacctttataccatgaacaactcctatgtcgcaacgaaaatcagcgaagcggtt
acgagtcttctgaaagcgaataaaatcacggcataa

DBGET integrated database retrieval system